CAZyme Information: I302_02337-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_02337-t42_1-p1
• CAZy Family: GH114
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	KI894019|CGC7	69819.06	8.2992

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894019:1290509-1292685(+)

Full Sequence      

MIPKPLILAFLIRTLLTLPFPQTYFQPDEFYQALEPAHNHVFGYGYLTWEWRDLPSPITG
DWWDMYVVGGRMRGWIWPGLFVGVYKVLQISGLDGTEMITIAPRLVGILVAALTDYYTYK
LASKVLSPGASASALFLSLTSLFNAHLLPRSLSTSPETLLTTMALCYFPFPALPSSSPAQ
DPLKLLSSDKATKEGTSEARLKKPERLDYIAMDRDVPWLPTIKCEESLFLSVVFATIALS
IRPTTASLWAYLGIDLIARTLRQSGVTSTERVIAVAAISLVATFAASTFIDYSFTGRLYF
PSLTFIHHNLIQNISSFYGSTNYLYHLTQSLPILLFPVWYWWIQGFAASLLPRFILPSRL
RRLDTPQPLRLLARAVTFSITTLSFSPHSEWRFLHPFLPSLLIFVIPSITTTYAPKVPCL
RLSQAIRQYTRLAKFPFYFVLFSPVLPFLYLNIFHGRAQVEVMNVLRRGDLGEIKSLVAL
TPCHSVPWQSHLHVKNMEGWFLTCEPPIGVNSDTHRTQQSFFYQSPVSYLQEVFPYPPAQ
LHEISNMTASPAEPSHLILFGEILGRLETHKGVSSTVSDELVHLGYERVWYGWNGFDLLQ
DEDERKGGLTVWRLVT

Enzyme Prediction     

No EC number prediction in I302_02337-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	7	493	2.1e-99	0.9948586118251928

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	5.39e-46	6	493	2	414	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	2.11e-40	3	506	38	463	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW42717.2|GT22	7.82e-240	1	614	1	657
KGB77702.1|GT22	3.63e-238	8	614	4	657
AFR93799.2|GT22	1.03e-237	8	616	4	658
AUB23376.1|GT22	1.03e-237	8	616	4	658
UOH80001.1|GT22	9.64e-237	8	616	4	662

PDB Hits     

I302_02337-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6CAB8|GPI10_YARLI	7.95e-68	7	614	22	510	GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI10 PE=3 SV=1
sp|Q6BH65|GPI10_DEBHA	1.42e-56	4	612	44	546	GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI10 PE=3 SV=2
sp|Q5AK24|GPI10_CANAL	6.17e-45	22	531	28	424	GPI mannosyltransferase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI10 PE=3 SV=2
sp|Q4V7R2|PIGB_XENLA	7.86e-42	22	560	67	487	GPI mannosyltransferase 3 OS=Xenopus laevis OX=8355 GN=pigb PE=2 SV=1
sp|Q4IB63|GPI10_GIBZE	1.99e-40	23	612	40	599	GPI mannosyltransferase 3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.089899	0.910066	CS pos: 25-26. Pr: 0.6177

TMHMM  Annotations     

Start	End
229	251
272	294
333	355
393	415
435	454