CAZyme Information: I302_01823-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_01823-t42_1-p1
• CAZy Family: CE9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721		83954.14	6.9310

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894018:4892247-4895094(+)

Full Sequence      

MSLRPHTYVTPSISPRTFAPPFPSRPVSPNMYLAEEKHLSQLSTYKRDPGKAAAAIRLAS
LQNVWAKADERRRSEDELEDGDVQRKTRRRRWYMYGGKPILRRWTIYGIGMFFLYLTFIR
PWLFQHEETPQEHYSFHGNSSRSISIKRSPASRSPVPRAPLPPALLAKTALEHKVEDGLL
KVNPQSTVHPIHQLIRDARDAWDKKMNRQSKTLLEATKEYQGRYGRRPPKGFDKWWEYVV
QNDVPLPDEYDQIHHDLLPFRALSPKELNKRIQQASKAVDTYTLRIKRGSIRINVSYSAD
IQGADERLEQQTDLLRPIAKYLPDMQMVWSVHDTPRSFIGWDHKRELIEHVEEEEWFDEN
DEIDLTLSDWSAACPPRSSIKSFNPLFSNPTWIPDTSLTSKSFISSHSQSLDLCSHPDII
PIHGALAGKIPKVNELIPIFTLSKTKLHSDVLGVPVEQWLQDDTLPEIPFEEKEINRLLW
RGSNTGTDHSVETPWRTSHRTRLIYLTNYQDENESENLKVDYIPPPKGIKSKVEMSKLIK
QDKLDHWNQRSMDLGFTGGPIQCNVDDGTCDDLMEEFSWTEQMTHDEALNYKYVIDVDGN
AWSARFKRLLASGSLILKATIMPEWWTDRIQPWVHYVPIQMDYSDLYDIMAFFQGLPATP
GETALARDIANAGKNWSATHWRKEDMIAYMFRLYLEWGRLVADRRSSMDFEYEERMEMRR
S

Enzyme Prediction     

No EC number prediction in I302_01823-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	432	701	5.8e-62	0.912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.80e-20	411	700	5	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.34e-12	590	700	215	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ97802.1|GT90	4.44e-165	173	714	82	644
CED83568.1|GT90	2.01e-153	165	710	149	709
CDZ98464.1|GT90	1.35e-146	168	711	142	691
QRW03676.1|GT90	9.13e-128	177	714	122	653
QRV74770.1|GT90	9.13e-128	177	714	122	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.02e-09	591	702	237	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	7.61e-07	581	701	262	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.29e-108	184	712	147	667	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.90e-09	591	702	265	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.49e-09	400	700	197	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.37e-08	591	702	265	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q7ZVE6|PLGT2_DANRE	1.84e-08	591	700	361	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

Start	End
100	119