CAZyme Information: I302_01711-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_01711-t42_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	KI894018|CGC18	48149.70	6.6197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894018:4571392-4573328(+)

Full Sequence      

MSRRRNSSPDIMYPSKKVMRFCVLSLCIIAGVWVFTLKTDLSSESLGNSQLLKRGLGSSS
VEAKEEHPIDEYVKTFPRVRSWKETGVPISPSVDQGLVIEDDDSMEMVNPNKVPFDWPRV
RKLFVFGDSFSTRDKDYRKDGVDWGHFQELHCKATDMKWADYLYAHMLILAIGTVLQYWN
LAKVGATIHHSVLPPGLESYGTFETQINDFEDLFTPLPGPTQVNWHSNDTLFIVVFGIND
NGRLNRDDLHGGGSLDVPATTKALVDSLMSQSRRLHSLGARNFLFMTLPPLHLSPKYKLP
SQVGYDIHERVEVSVKHFNDNLRSSVKQFEDELGDSNVMLFDLNKFWKILLDYPELFGIS
DVSRFRMTIDGRLPNFGRMGLAYHDNQHVSWSSAELIARSVNGLLMRNSASIQFSNASQT
EYTA

Enzyme Prediction     

No EC number prediction in I302_01711-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	123	401	1.3e-36	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	8.00e-27	122	401	1	267	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	6.07e-15	180	364	79	263	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.80e-13	123	375	1	213	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV72454.1|CE16	1.73e-17	117	374	24	265
QRW01498.1|CE16	1.73e-17	117	374	24	265
QRV87353.1|CE16	2.17e-17	117	363	24	248
EGX53944.1|CE16	9.16e-16	119	355	37	270
BCS08972.1|CE0	3.31e-15	87	365	13	287

PDB Hits     

I302_01711-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	3.31e-11	173	363	86	264	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	3.31e-11	173	363	86	264	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|Q99289|HLT_VIBPA	1.01e-06	224	363	233	354	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000008

TMHMM  Annotations     

Start	End
20	37