CAZyme Information: I302_01704-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_01704-t42_1-p1
• CAZy Family: CE17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644		70713.54	4.3796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894018:4547584-4549642(-)

Full Sequence      

MTSSIAYAFTLFSLLSLLPSLVSAAPDNDVTYQVSSNSFPNKCLSVQGNWNGAKVVLKDC
DEDDTTWKWTGSHLQNTATNKCIDIPDGGWWNGNKPQIWDCFSYNTNQQYAVSGNNIKWN
DWFCMDITDGKSDDGTLIQLWQCFSGNTNQQWTFTEVEEVEDGSDDEDCESVTVTATATT
MIGGGLWAGSPTANASVTANATASSTWMTASVTATASVTASASYWSSAPNNTASATASAT
SSASTSVSSGSVSSGYLQTSGSKIVDSDGNEVVLRGTNIGGWLVWEDWMCGITDSMNPDR
FPLNTLESRFGTDKANTLWEAWINNWLTEDDFNNFANIGFNVVRLPFGFRNLYDASGNWR
DDAFTHLDWAVAQAKARGIYVILDFHIWAGQQASYSAISENTSEGASQRAAVGEIWKKVA
QHYLGESIIAAFDVINEPTGSYGNNLQQDLYTAVRSVDANRIIIHESISTDPSQYGWTNV
IYSFHEYLMMGSDYSSNVNQYAQSVQAYVDMWTGYGIPSMLGEFMADGETLSYILNQANK
NNLSWLSWAHSTVNMGRWGLWNHQGFYVDVSSDSYDSILSSWSNMPSKQQSTIIYDQFKA
GATGSTSVSQRKRDVPTKRLTARHGGRSRRSNLPGSHGIQGISF

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	305	549	3.2e-52	0.9885931558935361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.82e-21	314	549	11	267	Cellulase (glycosyl hydrolase family 5).
395527	Ricin_B_lectin	1.06e-16	37	152	7	126	Ricin-type beta-trefoil lectin domain.
225344	BglC	2.12e-15	310	501	57	254	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
238092	RICIN	1.32e-14	32	154	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	2.12e-12	73	156	4	86	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOH79756.1|CBM13|GH5	7.13e-227	7	643	6	785
AFR92930.1|CBM13|GH5	1.43e-226	7	643	6	785
AUB22412.1|CBM13|GH5	1.43e-226	7	643	6	785
AAW41305.1|CBM13|GH5	2.53e-220	3	643	2	843
ADV19959.1|CBM13|GH5	1.86e-216	3	643	2	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.24e-11	266	501	3	264	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	4.41e-11	266	501	8	269	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PF0_A	7.81e-11	266	501	9	270	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	1.01e-10	266	501	3	264	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	1.03e-10	266	501	8	269	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.81e-27	256	553	3	340	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A1CRV0|EXGA_ASPCL	1.11e-17	273	524	41	308	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	1.14e-14	273	524	41	309	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.14e-14	273	524	41	309	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	1.41e-14	268	457	25	221	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000186	0.999796	CS pos: 24-25. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in I302_01704-t42_1-p1.