CAZyme Information: I302_01407-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_01407-t42_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	KI894018|CGC5	92343.93	5.4853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894018:3743138-3746396(-)

Full Sequence      

MQSKDSLRSFGTLWGSPVNNGRFIPCRVESAIGSVTHPESIVSNLVPQDRTDIQATTSLP
KGSLTLDGKGSSVVFDYGVSVAGIAFFDVDSTDPGVEIQVTFSESREFLDRPSGDGPISY
LAGPATYRNPILRPSAGINYLTEVQGGQRWQKLTLLTEGRVVLNSIGFIATISTVHPTRL
PSTFSCSNKSYNHLWDAGARTMQLCTAAKGSTPPLWEITEQGALISATRAIKHRASFDWK
AYTLAFDVLIHRAGCGWGVAMTNLQGYIFYVKSERLAHASISVFWGFTDEDAESVENIHL
GTTQLPVPIVQDASISIRTCVSPNEIAVSIDGIEVHRISSSKFCFSPITQSTEPQGCFGF
GPGADGLATYTNVLATSNLDGRTLYEDKMNTRSSLDDFGAGTTTLDCLLDGGKRDRVVWG
GDAAIMGPPVAYSTYTLEALKGSVDLLMSYRGRDGRFAAQVPPTHPWLTPLSSDFSLSYE
LYLIQSIYDAWMFGAISDGQLAELFPSVEQQLKRVETFIDENGLIFCGPDHAHDAREFNY
YDPPRIGHSTKLNAQYVSSLRQSVEFARSLGFNDAEKTYQSHADRTAEAINQRLWNEQIK
AYGITSASPEVIAQDANVQCILAGVADADRSRLVLETLSRELSHPEGVLAFDRTSGYRQS
ISNFVSGWHLFAAFKAGSQFHAKEILDKTLVPPSLPDHPAFTGTLWELMLTDGSPGMGGF
TSLAHGWATAATAVLPAYVVGIRPTAPCFRTFVVNPTKLGLSQASAVVTTPAGKITSEWN
SKSDVFTLHVSAPQILRGTVDLSNWGFDCENEYLIQVNNGSKSPFRPEKAEAIHFIGEVS
IIIVAQPVQ

Enzyme Prediction     

No EC number prediction in I302_01407-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	403	802	4.6e-57	0.7361111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	1.89e-09	741	802	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	1.39e-05	410	739	34	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225990	COG3459	0.002	557	682	764	898	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
407295	Glyco_hydro_36	0.002	547	647	199	308	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34696.1|GH78	3.58e-101	71	802	61	780
QMW46762.1|GH78	7.09e-100	71	802	61	780
CEI67897.1|GH78	8.25e-100	63	836	34	791
QRD93478.1|GH78	1.71e-99	71	802	257	976
UQC81548.1|GH78	2.43e-99	63	823	56	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.32e-08	403	783	325	680	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

I302_01407-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_01407-t42_1-p1.