CAZyme Information: I302_00468-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_00468-t42_1-p1
• CAZy Family: AA14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	KI894018|CGC17	46388.75	5.1018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894018:1235232-1237058(+)

Full Sequence      

MSIKPEYSAPMFDYRSYEVKEENVDELVARITKALVELEDKEGIHKYTIDDGRVIDSTSW
NFWEWQQAIGLYGLFNYYNLKISEDPSSAEGAKTLKIIKDWYTARAEEGGTTKNINSMAV
LLTLASLMEVEYQRGGIFSTEEKRLYEGWIDEWAEWAYHDCPRTEQGIFQHITFRLENKN
QVWDDTLMMTVLPLAKIGKLLNRPHYIEEAKFQFVQHAQYLMDATNGLWNHGFEFDGQGG
GHEWGHIAWARGNCWITIAIPIFLDMIQLSPNDSVYRVLKSVLHRQLDTLVKLQDQETGL
WRTVLLDETSYVETSASAGFVAGIFIGIRTGLLEEGKYISTGLSGLKACIAQVKPNGEVQ
NTSKGTPISSDPNFYKDMVKMTVGFGQALPIMALGEWLRYEKAKGKK

Enzyme Prediction     

No EC number prediction in I302_00468-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	399	5.6e-83	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.22e-74	50	399	23	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.33e-70	37	400	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE76464.1|GH105	1.49e-112	19	399	8	372
AYN26454.1|GH105	8.85e-110	1	399	1	376
UNK63307.1|GH105	8.85e-110	1	399	1	376
EGX50406.1|GH105	9.45e-110	28	399	20	378
QET66872.1|GH105	1.25e-109	1	399	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	5.14e-102	3	399	5	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	7.99e-102	31	399	15	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	1.09e-98	3	399	6	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	1.61e-11	141	375	161	387	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	3.73e-06	158	335	119	298	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	2.27e-38	63	402	29	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_00468-t42_1-p1.