CAZyme Information: I302_00291-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_00291-t42_1-p1
• CAZy Family: AA11
• CAZyme Description: endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		58040.48	6.7890

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894018:800777-803584(-)

Full Sequence      

MGNFTSKPASTPNTMKKDFLKVEGTKITLRGEEVVLKGTAIGGWMNMENFITGYTGHEHQ
VRAALKDVLGEEKYEYFFDKFLEYFFGEEDAKFFVSLGLNCIRVPINYHHFEDDMNPRVF
KKEGLKHLDRVIDICAKHGIYTIIDLHAAPGGQNFDWHSDNPTHKAAFYDHRDFQDRTII
LWEHLARHYKDNTWVAGYNPLNEPTDEKHVRLIDFYERVEKAIRKIDGDHILFLDTFAAD
FSHFGKPLPNSVYTCHDYSNYGFPSAPELYTGTKEQIQLHKDAFERKTEYMRKHKGPIWV
GEFGPVYQNAHDNIPNWETVNDSRFDVLNLQLDIYDKAKASWSIWVYKDVGFQGMVYAGE
YTPYVKLIWEFLQKQKRLAANKWGADDTQVRDLFKPIEEWLTANAPTIKTRYPSSGGVND
SWNVSGHLSRLVRNILLSEEMVKEYAELFRGKSREELDELAKSFKFDNCTQRTRLNEILK
KDSRRGEKGGHAQISEKAL

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	62	350	1.7e-124	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.89e-22	83	349	22	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.25e-16	84	348	72	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
225343	BglB	1.19e-06	88	204	62	169	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44253.2|GH5_22	3.32e-271	13	497	11	493
AFR96086.2|GH5_22	1.56e-269	11	497	4	493
AUB25961.1|GH5_22	1.56e-269	11	497	4	493
ADV22976.1|GH5_22	3.62e-257	12	497	10	467
UOH81960.1|GH5_22	1.33e-233	17	497	8	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.53e-15	73	296	16	231	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.09e-14	73	296	16	231	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	5.47e-12	98	345	46	286	Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	3.15e-11	98	345	46	286	Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]
5WH8_A	5.91e-11	127	349	89	275	Cellulase Cel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.33e-192	19	479	3	465	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P16169|GUNA_RUMFL	5.40e-18	35	321	7	278	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
sp|B0XN12|EXGA_ASPFC	3.88e-15	35	354	41	390	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|P23340|GUNC_CLOSF	9.66e-15	73	296	16	231	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	9.66e-15	73	296	16	231	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I302_00291-t42_1-p1.