CAZyme Information: I302_00212-t42_1-p1

Basic Information

• Species: Kwoniella bestiolae
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella bestiolae
• CAZyme ID: I302_00212-t42_1-p1
• CAZy Family: PL14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		59284.40	5.0017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KbestiolaeCBS10118	9270	1296100	137	9133

• Gene Location: location=KI894018:584012-586273(-)

Full Sequence      

MSLTSFLDTLRSQRYSLLPTNSSPASPDLIKPSSSTKKRLFQATALALVLLVITGYSLRP
TKNGLETQVADPYEQFTDPNFHSELDPNLGLGGEDESADSENEKEPLSFPDIDVGSEEPP
NGQSKQPNQGQIDASNWGLTEVMGWRAPNVGLKDLGEVAESRYRLGFEAGEEGAREYYQR
LHDFALSLPMPLHSPLLSSLFYHSPPQYNAVVPSYPLSSGTKPPPKSMISYKYIHQTDKT
FDPDNQLTKIWTDMNAPDGWELNFLDDTQAHEWMLKYFKRSDVSWAWDYMHRGVLKADFL
RYLLPLIMGGVYSDVDTQPIRPIEQWGHNSVEYLDLSSTDGSGWRSKLSTNPAVIVGVDV
DVHAYEGWENGWPRALGICQWTLSSSPSHPIFLDAVRRVVNATRVVEEWENWRAEEIEKL
LGEGRESDAQALKEQHRDHAMNVMEWTGPGLFTDSVMGFLLARYNVTWHRLRGLNHPLRI
GDVLILPITGFSPGGQPDFKAEGPDSVQANVLHNFRGSWKPDGARKK

Enzyme Prediction     

No EC number prediction in I302_00212-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.42e-14	188	494	48	322	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.09e-07	257	327	16	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43978.2|GT32	3.89e-195	1	524	1	500
AUB26041.1|GT32	1.47e-192	11	524	10	500
ADV23039.1|GT32	1.47e-192	1	524	1	500
AFR96155.2|GT32	1.47e-192	11	524	10	500
KGB75873.1|GT32	2.02e-190	1	524	1	491

PDB Hits     

I302_00212-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.60e-39	232	522	144	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.38e-33	221	523	96	379	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.90e-25	249	522	122	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.73e-20	294	520	196	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999985	0.000031

TMHMM  Annotations     

There is no transmembrane helices in I302_00212-t42_1-p1.