CAZyme Information: HpaG814555:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG814555:RNA-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		34393.67	10.1539

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0904:10-912(+)

Full Sequence      

MGQKPSPSILYPKATKESGKVLRLKQQHVFVSASTQDILHRFTNYNSDWNTLPDKVAIQL
NDTHPAIAVAEMMHQLVDHYHLQWDRAWGLVTKMFAYTNHTLMPEALETWSVDLFAQLLP
RHLEIIYEINHRFLQMVNQHFPGDTGLLSRVSIIDETHGRRVRMAHLAIVGSHTVNGVAE
LHSELLKTTLFADFTKIYPGKFTNVTNGITPRRWLNQANPLLTQLLTKHIGTGFQKDLSL
ISKIEPFADNAAFRKAFREVKKANKQRLADKILQKTGIAISADALFDVQIQRIHEYKRLY

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	8	298	3.7e-105	0.40059347181008903

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340853	GT35_Glycogen_Phosphorylase	8.67e-180	8	298	254	542	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
273967	P_ylase	2.00e-167	9	298	252	541	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
395272	Phosphorylase	6.16e-141	9	298	171	409	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
184948	PRK14986	7.90e-129	9	298	268	557	glycogen phosphorylase; Provisional
223136	GlgP	3.85e-122	10	298	228	501	Glucan phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC53416.1|GT35	2.34e-189	2	298	279	575
QDC44704.1|GT35	2.34e-189	2	298	279	575
QDC49711.1|GT35	2.34e-189	2	298	279	575
AKR43892.1|GT35	4.69e-189	2	298	279	575
ACT51003.1|GT35	1.28e-144	9	298	278	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	1.18e-93	8	298	313	614	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
3ZCP_A	2.65e-91	9	298	279	576	Rabbit muscle glycogen phosphorylase b in complex with N- cyclohexancarbonyl-N-beta-D-glucopyranosyl urea determined at 1.83 A resolution [Oryctolagus cuniculus]
2GJ4_A	3.68e-91	9	298	267	564	Structure of rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	3.74e-91	9	298	267	564	Structure of rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
4EJ2_A	3.74e-91	9	298	267	564	Crystal structure of GPb in complex with DK10 [Oryctolagus cuniculus],4EKE_A Crystal structure of GPb in complex with DK11 [Oryctolagus cuniculus],4EKY_A Crystal structure of GPb in complex with DK15 [Oryctolagus cuniculus],4EL0_A Crystal structure of GPb in complex with DK16 [Oryctolagus cuniculus],4EL5_A Crystal structure of GPb in complex with DK12 [Oryctolagus cuniculus],4MHO_A Crystal structure of Gpb in complex with S3, SUGAR (N-[(BIPHENYL-4-YLOXY)ACETYL]-BETA-D-GLUCOPYRANOSYLAMINE) [Oryctolagus cuniculus],4MHS_A Crystal structure of Gpb in complex with SUGAR (N-[(2E)-3-(BIPHENYL-4-YL)PROP-2-ENOYL]-BETA-D-GLUCOPYRANOSYLAMINE [Oryctolagus cuniculus],4MI3_A Crystal structure of Gpb in complex with SUGAR (N-{(2R)-2-METHYL-3-[4-(PROPAN-2-YL)PHENYL]PROPANOYL}-BETA-D-GLUCOPYRANOSYLAMINE) (S21) [Oryctolagus cuniculus],4MI6_A Crystal structure of Gpb in complex with SUGAR (N-[4-(5,6,7,8-TETRAHYDRONAPHTHALEN-2-YL)BUTANOYL]-BETA-D-GLUCOPYRANOSYLAMINE) [Oryctolagus cuniculus],4MI9_A Crystal structure of Gpb in complex with SUGAR (N-[(3R)-3-(4-ETHYLPHENYL)BUTANOYL]-BETA-D-GLUCOPYRANOSYLAMINE) (S20) [Oryctolagus cuniculus],4MIC_A Crystal structure of Gpb in complex with SUGAR (N-{(2E)-3-[4-(PROPAN-2-YL)PHENYL]PROP-2-ENOYL}-BETA-D-GLUCOPYRANOSYLAMINE) (S6) [Oryctolagus cuniculus],4MRA_A Crystal structure of Gpb in complex with QUERCETIN [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00766|PHS1_DICDI	2.16e-102	8	298	298	589	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P0AC86|PHSG_ECOLI	2.95e-101	9	298	268	557	Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
sp|P0AC87|PHSG_SHIFL	2.95e-101	9	298	268	557	Glycogen phosphorylase OS=Shigella flexneri OX=623 GN=glgP PE=3 SV=1
sp|P45180|PHSG_HAEIN	1.15e-97	9	298	273	562	Glycogen phosphorylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=glgP PE=3 SV=1
sp|O84250|PHSG_CHLTR	1.40e-97	9	298	269	558	Glycogen phosphorylase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HpaG814555:RNA-p1.