CAZyme Information: HpaG811032:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG811032:RNA-p1
• CAZy Family: GT33
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1083		119180.71	5.2397

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0144:58743-62063(+)

Full Sequence      

MAQGVFGLLLLLWTCVSAVPGADLKLPLPFPVTSHPLQLPSSLFAASERLPLNAHVVNSS
TMGNPKLLADVPFPTGAWWTNLVLAEGKSAIASLPYVFKILSEKLHVSYPFRVVTPTDIV
EGFIAQMVFSSQPSGLSSLPMAHHVVDFDDFSTTVRFSQGQTEAFRVFLVRGSPYITMEF
RHSRPLIEAMDGLQIVHFKRLLGLKLMNGDEVPFATFAAELNNGQTWYVYASDSTLELQL
NRNRQLTTDMEFTGVLRVALCLDAILWPHLLESASVYAVGGEVVHSMDPQDPEKALLDFQ
WKTRSFSTFHGQTDEVTAEENDKLLMLTLPHHLDVMQVQKGAGTLKEGKNRLLPKLKYIC
IRGPMQGIFGAVWHMEETLTPVEWNYADEGVFSEDFSSSSVDNKRKRLDMRETVKQAILH
ELSIDADKYPQPLSPDVYNFGKQVSRDARLLLIADKFGQEEMKLKLLTKIEMELVDWLNA
TNANHFVYDQTFGGVITNDGWHNKEADYGNGYYNDHHFHYGYFIYALAAIRKLDPDFIAE
YSQACALLIGDIGTPLLNSNTPFFNDLPAQLLFPTARHKDWFVGHSYASGLFPMEVGKSQ
ESSSECINAYYSLTLFSSLDEDASKGQGHSSYHRFARLLLATELRSVKKYWHMRQNSDIY
EPVFAKNAMVGVVGELSVVYNTWFGNRAVYIHGINMLPFTPITPQLLDEKFVAREYPILS
QDLPDLGPHDIWRSIVVMDHAILNAAEGWEELTNTVESFDTWSSRTNAMYWIATRPSWFE
QKNRPELRGPPVDVETTCFGYPACASAGANGTALMCCGTLPGCCPSALGCCPQDSSDDLP
SNACYGEHECAVLGLGCCTSIDGCCDPDPVSGTVLGCCKNQHVVASNVTHKAEGQLKDSA
FCFGEPLCEAANLDCCSAPGGCCSNAESKLGCCLSKKTSAAGSSTPQSGKDSCHGQPLCG
AAGLDCCSWDGGCCKPDPVTGGKLDCCQDERADKPSRDKRPVHIGNGEENDGSQDSPGGF
NSGITRILIGLGMAIMLVLMVYAVGLCYRRRGYSNIDGDMRALYCAGLMVGVIAFFIFLV
VTS

Enzyme Prediction     

No EC number prediction in HpaG811032:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	70	771	1.7e-150	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.81e-74	438	766	32	346	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.26e-72	72	772	89	748	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.81e-55	70	387	12	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	0.0	9	1083	8	1080
CCA18874.1|GH81	3.92e-220	71	913	28	876
AGP40408.1|GH81	1.15e-106	72	776	79	702
AUX36386.1|GH81	4.12e-103	72	776	90	713
CAN97272.1|GH81	4.59e-100	67	776	88	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	4.42e-49	74	781	42	724	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.60e-49	74	781	67	749	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.41e-47	74	781	42	724	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	3.60e-32	72	759	48	665	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	4.07e-32	72	759	68	685	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	2.37e-39	217	766	183	693	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.63e-34	437	773	412	732	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	2.69e-33	155	750	328	874	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.76e-33	64	769	420	1100	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.46e-30	72	744	110	744	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999774	CS pos: 18-19. Pr: 0.9820

TMHMM  Annotations     

Start	End
1027	1049
1062	1081