CAZyme Information: HpaG810917:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG810917:RNA-p1
• CAZy Family: GT24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		39299.60	8.0634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0141:37773-38822(-)

Full Sequence      

MLHPVLRSSSAVRPLRRDSRCLIHFSATATTEYDYVIVGGGSAGCVLANRLTEDANNKVL
LVETGPDDRKKWDSWKIHMPAALTYNLADYKYNWCYYTEPQRHLNGRVLPWPRGRVLGGS
SSLNAMVYVRGHAYDYDDWQESGATGWSYADCLPYFRKAQNHELGPDEYRGGDGPLHVTR
GNQKDQILFQKFIDAGMQAGYPFTDDMNGYQQEGFGWMDMTVWKGRRWSTASAYLRPAMT
RLNLTVVTDTFVSKVVFEGKKAVGVEMEDRKKKTTAHVRAAKEVILSGGAINSPQLLMLS
GVGDADHLTEVGVPVVQHLPAVGRNMEDHLDLYIQYMCKKPITLHNATW

Enzyme Prediction     

No EC number prediction in HpaG810917:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	32	344	3.1e-111	0.5686619718309859

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	28	347	1	317	choline dehydrogenase; Validated
225186	BetA	1.31e-124	26	349	1	323	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.59e-66	105	331	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.80e-21	14	328	33	326	Protein HOTHEAD
240384	PTZ00367	3.85e-05	27	67	28	71	squalene epoxidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	3.38e-212	1	349	1	344
AWP09430.1|AA3_2	5.27e-150	30	347	17	334
ANI26486.1|AA3_2	3.36e-147	30	347	68	385
CAB3230510.1|AA3_2	3.41e-144	27	347	19	339
CEF60566.1|AA3_2	4.23e-117	35	349	35	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NCC_A	1.42e-57	8	328	1	321	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	5.70e-57	26	328	1	305	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	5.70e-57	26	328	1	305	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	5.70e-57	26	328	1	305	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	7.96e-57	26	328	1	305	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	3.91e-148	32	347	45	360	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	3.08e-146	19	347	27	355	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8BJ64|CHDH_MOUSE	3.00e-144	21	347	31	357	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	3.55e-111	31	346	3	313	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q48CM7|BETA_PSE14	7.96e-110	28	345	2	319	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000002

TMHMM  Annotations     

There is no transmembrane helices in HpaG810917:RNA-p1.