CAZyme Information: HpaG810356:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG810356:RNA-p1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	HaraEmoy2_SC0124|CGC1	87658.28	4.9081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0124:23996-26353(-)

Full Sequence      

MKFLVRAAAVAIVVAGRSARATVDDPDVGEGFNYRDKTVEAATQKLVHASIPPSTGSVLH
QGPIVQGPMASSPYSTSGGYFAPFGFDAPSETLYKRNGSLARLAPIINVAPEALNQPIPT
NEWWGNLIHATATNTSENFPAWAQPYAFMLPKVPPFGLQTYYPYTYREMAPEINGTVRYY
EHGIHNDLMLSAREFNESRPTYEVYAWSDMGIKLRLCSRGSINCIDSALSSGMAFVSGTY
KGLTPRIETEYNITFVEESVPGKFIVYLNNNQTWVLYASDVSLSLRVEESVNFSMNASGS
SLVADDTYAGTIRVAILPEGAADTLYDDYVSCIVRGGTVSMESRTGYSLTWDAEGSSCDT
VGLLHFALPHQVESMIGSPITAETPGAIMLNSTTRGLMVAQVSMRWSFVVPEADIAIDYY
PDRKRLSLYLIRETDMLRTLQDDIYANWTLATNSWYFNGKALQKYASLCLMAADSLVVGP
DTNGLLAYCIEKLETLVEPLLNNTLSPPLVYETLYGGVVSGLIFDTGQLYMDFGSGIYND
HHYHFGYYVTSAAIIKHLDPTWSRMPDLEDLIWMLLRDVTNPSLEDPIYPRFRHFSWYHG
HSYSRGVTLLDHGKDQESTSEDLNFYYGMTLWGKETGHKALEDLGSLMLRLNAYTVREYF
LLSSDNKIHPPEIVRNRVTGIFFDNKVYYNTWFLDEKYAIHGIQMIPVSPANALARTPAF
VTEEWNEILSKEPIVTMKNSNNTWLSLLLVNAAVVNKMDSLYKLMNATMDDGLTRSWALY
NAASA

Enzyme Prediction     

No EC number prediction in HpaG810356:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	109	780	3.5e-158	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	3.58e-122	117	783	89	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	9.20e-120	452	779	28	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	6.81e-47	112	421	9	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26131.1|GH81	0.0	65	784	1	713
UIZ26137.1|GH81	0.0	79	784	121	823
UIZ26602.1|GH81	0.0	79	784	121	823
UIZ26438.1|GH81	1.88e-300	78	784	42	739
UIZ26440.1|GH81	1.88e-300	78	784	42	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.80e-91	118	784	41	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.04e-91	118	784	66	742	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.57e-87	118	784	41	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.73e-26	314	729	203	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	6.25e-22	539	771	439	664	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	4.17e-84	229	783	187	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	3.83e-81	117	783	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.42e-77	116	785	459	1141	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.55e-73	117	783	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.05e-72	117	779	433	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.010442	0.989520	CS pos: 21-22. Pr: 0.8531

TMHMM  Annotations     

There is no transmembrane helices in HpaG810356:RNA-p1.