CAZyme Information: HpaG810285:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG810285:RNA-p1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746	HaraEmoy2_SC0122|CGC1	84509.56	6.6106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0122:133263-135503(-)

Full Sequence      

MSPSSVSSCNYTTEDNRHGIQALKRVALLADSTKWWGDRDLSHEEEHLPLIPGSRDHNCG
REPQPKHQHVAGCKPNHLGLPSGRTLLRILEIVVVMVIVAVELKALSTRSTNHGVHKVPS
FSLHHSSGKLLSGGHRLRSFLRHMKSQPCVLSAVSTEKEIPLGVNVEMERAMDIYCRGPL
LHAVQMANVYSDSKYFVDMPIKDNSSAFDILVDFQHRGLAMTVYRPNVQGMHKQQLRQFI
DDHFDPPGTDLLPITPFDYQGQVHPPMVADIRDKELRDWAFDLHQIWQSLGRIRNPHVKG
SLLHSRKLDEPSLNQPDNVLIVPGGRFRESYYWDSYWIVQGLLVSDMSVTARGIVNHLLE
YVSEFGFVPNGGRIYYLTRSQPPMLSDMVKLVARLPVNGTDIEYDDEYLQAALPILEREY
DFWMQHGPSGHAVEFTRSDTKLGATGDVTYVLNRYTSNANHPRPESYREDVLVASEIFDR
TIHMDGGNAAATERHKDEYYNNVIAAAESGWDFSSRWLRDPFDMKSMVTTSVVPVDLNSI
MYRVERNLMEFNQHLGNDKRAQFFERAAARRLKAIDAILWSVKHQSWKDYDLETDTHSVI
VSVSDYTPLWAKAFNASDIDRLKTVVTSLKNSGLLQVGGIQTTTTFSGQQWDMPNAWPPE
QDIVVEGLLAINTTESHNLARELTRTWTQTSLTAWKQTGLMFEKYNASEVGGLGAGGEYF
PQFGFGWTNGVILKFLTIHQNLLQAD

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	190	737	2e-160	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	1.26e-180	175	736	13	541	alpha,alpha-trehalase
395961	Trehalase	6.35e-166	190	739	3	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	6.86e-99	157	737	39	550	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	5.65e-94	178	736	49	533	alpha,alpha-trehalase TreA.
183936	treA	6.51e-90	180	739	52	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20368.1|GH37	0.0	2	746	5	749
CCA17719.1|GH37	9.51e-247	172	744	125	706
CCA18365.1|GH37	9.51e-247	172	744	125	706
CCA21422.1|GH37	6.53e-239	172	743	163	744
AOW41677.1|GH37	4.85e-223	151	743	25	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	2.56e-108	192	736	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	3.87e-107	192	736	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	6.15e-80	178	736	52	536	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	4.55e-77	178	738	15	501	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	9.28e-73	178	738	15	501	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8J4S9|TREA_APIME	1.41e-125	173	746	44	575	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q54QZ5|TREA_DICDI	1.12e-117	174	736	53	582	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9W2M2|TREA_DROME	3.29e-117	163	739	38	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	7.18e-117	162	745	11	553	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	2.06e-114	162	745	14	556	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HpaG810285:RNA-p1.