CAZyme Information: HpaG809590:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG809590:RNA-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		45128.72	8.3955

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0104:172402-173774(-)

Full Sequence      

MERSVVAFAVVTRASVTLLALLTSAIVTPYDTSSHLQSGGSALAALSNWDGVYYSHIALH
GYDFEHFHAFFPLYPLLTRWLSHLIPLNAASAVIVSGWCISNASFVLAALFLYRLGCVET
GDELVARRAAYLFCVAPSSIFMSAVYSESLMCLFSFSGMYFLAKHVHAPKPRRAFQDLVY
CAMLFGAASATRSNGILLSSVLGALAVVPQIVYFVVSMVPYCPSLVQHLGGNISETAEMK
DRSWCTEVIPNLSAMYTFIQSEYWNVGLFRYYELKQLPNFLLAAPILSLSLHALRGYFRG
NVVPGRSRATLHQEVNTGSSRGTPLAPYYAHWLFLVVNALLVVHIQVTTRLLCACPPLFW
HPAALICDPAVERKASPVLTRYGRAIVCYFLLFTVLGSVLFPSFYPWT

Enzyme Prediction     

No EC number prediction in HpaG809590:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	5	408	5.2e-95	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.13e-49	5	408	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.84e-14	66	294	91	316	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	3.09e-232	2	408	6	439
CCA18790.1|GT76	1.86e-106	2	408	6	490
ACO67127.1|GT76	7.10e-55	26	408	26	421
BAF29832.1|GT76	1.67e-52	5	408	8	486
BAT17237.1|GT76	1.67e-52	5	408	8	486

PDB Hits     

HpaG809590:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q290J8|PIGV_DROPS	1.50e-33	42	408	59	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q7TPN3|PIGV_MOUSE	6.58e-33	43	408	60	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q9V7W1|PIGV_DROME	7.12e-33	43	408	56	449	GPI mannosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=PIG-V PE=1 SV=1
sp|Q9NUD9|PIGV_HUMAN	2.13e-31	43	408	60	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	3.96e-31	43	408	60	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.745351	0.254646

TMHMM  Annotations     

Start	End
5	27
94	116
129	151
195	217
277	294
328	345
385	407