CAZyme Information: HpaG809439:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG809439:RNA-p1
• CAZy Family: GT1|GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		60699.38	7.7829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0101:86008-87803(-)

Full Sequence      

MALSWGGYVFIINLVPIHVLVMLLSGKYSSRIYVAYATFYPLATLGVMQVPFIGFNAVLK
GENAGSHGVFALLQVYAFMRWLSTQLSTRHFLQLLRICVRTGIVIVVGGLLLVLLLGKLQ
WSGRSLTLLDPTYASKYIPIIASVGEHQPTVWSAFYFSLGPAMLFIPLGLFYTFQKLDTA
SVFMIVYSTFAFYFSGIMVRLLLTLAPVACYLSAVGLSGFVHKIIESTRREPGKVEECQA
MATSTIAIGDEEKHCKEEPVEDVLSAVCTMLRFQSDGRVAGKRQKAPKALLLLAVACGLL
LVIHVRQSFKIASKVYSSTSLVFEKMNTSTMKSDVHDDYREAFAWLRQNTPENAKILSWW
DYGYQITTLANRTVLVDNNTWNNTHIATVGRVLASREEDAAPILQSLDVNYVFLQFGGKV
GLPGDDLNKLPWIVKISEGVFPDDVVESEFQVNGRYVFHENATLAMTESVLYKLSYFEFN
QVQSSTGAEDKDPVFGWDLNRRVRISQHDIDLHHFEHVFTSHEWIVRIYRVKSAAAFPLS
T

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	1	482	3.4e-93	0.5873015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	3.38e-39	1	218	189	410	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.20e-27	1	476	208	673	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	2.08e-08	139	412	340	584	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA17694.1|GT66	7.41e-157	1	531	192	741
CCA18340.1|GT66	7.41e-157	1	531	192	741
UIZ23018.1|GT66	6.52e-149	1	532	250	737
CCA15036.1|GT66	1.01e-146	1	532	249	736
CCA23157.1|GT66	1.01e-146	1	532	249	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FTJ_5	4.04e-121	1	532	205	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	5.14e-121	1	532	205	695	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	5.14e-121	1	532	205	695	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	5.60e-120	1	533	259	774	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6C26_A	1.49e-108	1	532	204	683	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FX21|STT3B_ARATH	2.12e-127	1	532	228	729	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana OX=3702 GN=STT3B PE=2 SV=1
sp|Q7XQ88|STT3B_ORYSJ	2.50e-125	1	532	215	715	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Oryza sativa subsp. japonica OX=39947 GN=STT3B PE=2 SV=2
sp|Q93ZY3|STT3A_ARATH	2.98e-121	1	532	210	747	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=2 SV=1
sp|Q2KJI2|STT3A_BOVIN	3.38e-121	1	532	205	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1
sp|Q5RCE2|STT3A_PONAB	2.64e-120	1	532	205	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

Start	End
4	26
33	55
65	84
97	116
150	172
179	198
202	221
289	306