CAZyme Information: HpaG809280:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG809280:RNA-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		37453.50	9.6889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0098:144158-145201(+)

Full Sequence      

MKIFVPSAVALISIMTMIVANAITCSGPHARVEPPAGALVVDAAANPKYKNSFRTLAGAV
NKLDLSSGNQQTIFILSGLYKEKVTIPFLNGPLVLQGATCDATSYAKNQVTIAQATAQKN
LPNDVTNDRNALTSTVLFKSNNVKVYNLNIANTAGNVGQAVAVTVDGENYGFYGCDLRGY
QDTLLTKKGKQLYAKSRITGAVDFIFGLEAAVWCERCDIESIGAGCITANGRSSNGSNSY
YVFNHARVYGSKGSLVGKTFLGRPWRPYARVVFQNSELSNVVNAAGWSKWNGQSPDHVHF
REFKNVGPGAAKRERAAFSQQLTQAVSINQILGDNYKTQSWVDLAYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	325	1.9e-74	0.9270833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	2.10e-47	50	342	20	292	putative pectinesterase
395871	Pectinesterase	4.00e-46	53	315	12	271	Pectinesterase.
178113	PLN02497	1.04e-43	52	326	43	311	probable pectinesterase
215357	PLN02665	5.15e-43	53	323	80	341	pectinesterase family protein
215173	PLN02304	1.37e-42	53	325	87	359	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54868.1|CE8	3.24e-131	1	347	1	343
ACO54869.1|CE8	4.47e-130	1	347	1	338
AFM08806.1|CE8	1.28e-129	1	347	1	338
ABQ63096.1|CE8	2.69e-118	1	347	1	344
ACO54873.1|CE8	1.54e-117	1	347	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.27e-56	29	346	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	8.83e-56	29	346	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.59e-30	53	318	19	281	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.66e-25	39	315	1	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	5.03e-18	52	334	17	336	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.95e-71	31	346	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.66e-70	31	347	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|A1DBT4|PMEA_NEOFI	8.16e-63	31	346	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	4.68e-62	30	346	28	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	6.42e-62	31	346	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000456	0.999509	CS pos: 22-23. Pr: 0.9561

TMHMM  Annotations     

There is no transmembrane helices in HpaG809280:RNA-p1.