CAZyme Information: HpaG808603:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG808603:RNA-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42480.31	5.0109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0084:35047-36168(-)

Full Sequence      

MEKSRGVNLGGWLVAENWMTADAPFWQEIGDQYVGSGEYTAITKAVNPDLVRSKLRDHHA
NFITESDIRQIAAAGLNTVRVPVGYWIIGYDNQDPANQREWEVYPKGTIQYLDRLIRDWG
MKHNVSVLVGLHAAKGSQNGAEHSSPTSHGQSYWSQYSENVDNSIEVVRFLADRYLNDEA
FLGIGLLNEPGPSTNESVLYQYYQDAYQAVRSTGSDCVLSIAPTLLKQNPDEMMGFMTTP
EFTNVWVEWHPYFVWGYENKTDEHLLNVSLKTVYKGRVEKWNARPGHNPLFIGEWSFSTA
SNMLRQNPDFFYTFAEEQLKAHELAEGGYTLWSWKARGVNESIDVEAWSLQNLLADDRIG
QMLRGTGQYKRQG

Enzyme Prediction     

No EC number prediction in HpaG808603:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	55	336	1.2e-47	0.9638989169675091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.05e-23	1	276	15	266	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.65e-10	62	338	24	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29004.1|GH5	1.28e-196	3	364	47	407
UIZ29069.1|GH5	1.14e-145	3	372	58	424
CCA17636.1|GH5	1.82e-100	3	354	137	489
UIZ29723.1|GH5	3.21e-100	5	356	13	357
UJR33211.1|GH5	2.14e-98	5	354	42	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	8.17e-37	5	353	10	372	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3N9K_A	8.94e-37	5	353	15	377	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1CZ1_A	1.13e-36	5	353	10	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	1.24e-36	5	353	15	377	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
3O6A_A	1.24e-36	5	353	15	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	3.86e-38	2	363	35	407	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	1.38e-36	2	363	27	394	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q12700|EXG_SCHOC	7.18e-36	3	354	41	405	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|O93983|EXG2_WICAO	7.42e-36	2	296	40	318	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.70e-35	5	353	54	416	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HpaG808603:RNA-p1.