CAZyme Information: HpaG808513:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG808513:RNA-p1
• CAZy Family: GH63
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1228		135120.08	6.4248

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0082:46701-50387(-)

Full Sequence      

MSPRNEFFVSQRAATDLELSRLDTSLSLEEQEILATIQELQLQLMHLRAAEELENRSPAS
TADESLAPSGSNHQLIVVSNNLPVLLERQPQTGQWKATKTTGGLDKLMCLTGVRAEMDFL
WVGWVGQPIPKSEHEAVRSLLLQHKCLPVFLSSDVAARHTSFSSEVLWSLFHYVSEPVPL
LNTGGNSSFYSTKRFNKQDWRAYESANESFADAIAEVYNEGDSVWVHDYHLMLLPSLLRQ
RIPLCRIGWFLHTPFPSSEVYCRLPVRSQLLTGVLQADLLGFQTFDYERHFLSTCHRLLG
VECTHKGVRSALANRDHFTSIGVFPIGISLEPFARVASSRPTLDRVNELHEKFGGKRIIL
GIDRLDNIKGIPHKMLAMEMLLDRFPEWQHNVVLVQIGISSRSGVVESQAIRGSSTSDRR
SSVNKATGENSNGLPRTSPYPIVGPKSSISSDSPIKGVSESPSTAASSIAAGKGNSSGYD
ACYPLEMSSHSYHNILIQVNQIVGRINGIFGTLDYAPIHFIQQQATPHDELCALYDLADV
CLVTSTRDGMNLVSHEFVVCQQHFMRNKDERMKAAHVATRESSDPSGKADGRLESIGASN
ALRDNATKCGALPPIPSPRESSTSVLTDWEGEDGGPGVLVVSEFAGCSQSLSGAIVINPW
NSEDLALSIHQSLSMCRTEREIRQQKLYRYVSSNTASVWGRQFLEELGVAVEKNRKSSTQ
LPKLDKKAIVRAYTSAQNRVIILDYDRTLTPQHSLLPLAAVGPNFKSLLDALTADERNTV
FIVSGRERKFLETWLNGMRVGVAAEDGFFYRMNLSNTREQWKTMSKFQYDVASARSGGST
TATIAGMGSVGSVDTSYSSEAHGGMMHMSMGSLPTYAQHGSAPRSTDTADGTPFATGSAA
TDDSFGGDDMSWKDLVLPTMLTFTDRTPGSYIEDKESSLTWHYGDADPHFGSWQAKDLQI
ILERQLIGTALEVYQGRMAVSVEHEGCTKTRVLEGILKHLSLPEQIAKKSGQEVDFVMCV
CDDVTDDQMFQTLNALVTESNERHEERKRREEQAANERIRRNSIAGGNPVPVQLHARPVP
SAAHVSKAKPRMPKLRVKSDTTDEVEPSVKPKSSMKKRNQNVGAAAAAVRGHEDYSTDED
DELDAGENMDDDNKVAFSRLQKVPVQLAENVAIFAVVVGPDVKHSGGRHASSFAVDSLAD
VRTVLKDFVDESRKGTNRASPAPVTPGS

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	71	413	4.1e-109	0.6821052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	75	1033	3	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	2.08e-171	74	707	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	2.13e-166	75	707	3	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	9.15e-163	16	1020	52	796	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	1.21e-156	70	1020	8	706	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29831.1|GT20	0.0	1	1223	24	1220
CCA23376.1|GT20	0.0	2	1212	479	1629
CCA20339.1|GT20	1.70e-185	2	1030	21	795
CCA16456.1|GT20	3.05e-185	26	1030	127	878
QOX06485.1|GT20	1.31e-168	18	1037	7	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	7.82e-109	65	728	3	496	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	8.72e-109	74	707	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	9.68e-108	69	707	7	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	3.49e-107	74	707	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.30e-106	74	707	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	1.64e-147	69	963	12	644	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	6.27e-127	60	1038	44	795	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	3.69e-125	71	1020	90	794	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|Q9FZ57|TPS2_ARATH	1.01e-123	70	1019	9	707	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|Q9LRA7|TPS9_ARATH	1.62e-123	69	1038	55	800	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HpaG808513:RNA-p1.