CAZyme Information: HpaG808512:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG808512:RNA-p1
• CAZy Family: GH63
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	HaraEmoy2_SC0082|CGC1	45514.78	4.8339

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0082:44999-46536(+)

Full Sequence      

MKTALLVACLSTHFLGPFDRPVNAYNVIDNDAADEIEEDDDSSFDFMSSNMEPNPDLVEV
QCDGLECPVDRRDRMDDVPSAWTRGLVTPKIKPELILKEHARASSSSQKLFRGETLGYVT
PWNSRGYALAKRFRSKFTYISPVWLQVREDRNHVPIITGLHEIDRQWVQDVKHGVEGDVK
LAVDPAVVPRVVYERNQLKSEDVPLITNLMLDLMNEHDFDGIVFEIPVMQGTLDMLRQLA
RAFRAADKLFILVLPRSSNDGEMPMTHELFAELAPLVHRFSMNAYDFGTPGPNAPYSWLA
KTLEKMSPMERQRILMGLPFYGYDNADAITGSAYIQALTDNDVTIRWDLTSHECQHVYTA
AESSRQHVLFFPCLQFLQDRLTLYKANGVGVAIWELGQGQC

Enzyme Prediction     

No EC number prediction in HpaG808512:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	209	398	2.9e-21	0.6554054054054054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119355	GH18_SI-CLP	1.09e-87	111	399	1	310	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
119353	GH18_CFLE_spore_hydrolase	1.35e-26	114	398	3	304	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
226376	YaaH	2.40e-15	204	398	194	409	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
214753	Glyco_18	2.25e-11	116	398	3	333	Glyco_18 domain.
119366	GH18_trifunctional	1.21e-07	114	398	1	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29463.1|GH0	3.00e-167	19	399	15	374
CCA23370.1|GH0	6.80e-80	101	400	505	803
CCA23365.1|GH0	7.16e-80	101	400	508	806
CCA23369.1|GH0	7.53e-80	101	400	511	809
CCA23367.1|GH0	7.53e-80	101	400	511	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BXW_A	5.08e-66	84	399	48	385	Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens],3BXW_B Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q922Q9|CHID1_MOUSE	6.09e-67	84	399	48	385	Chitinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Chid1 PE=1 SV=1
sp|A0JPQ9|CHID1_RAT	3.36e-66	84	399	48	385	Chitinase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Chid1 PE=2 SV=2
sp|Q5RFF6|CHID1_PONAB	2.61e-65	84	399	48	385	Chitinase domain-containing protein 1 OS=Pongo abelii OX=9601 GN=CHID1 PE=2 SV=1
sp|Q9BWS9|CHID1_HUMAN	2.61e-65	84	399	48	385	Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1 PE=1 SV=1
sp|Q66IL0|CHID1_XENTR	1.00e-56	83	399	48	386	Chitinase domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=chid1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.619045	0.380956

TMHMM  Annotations     

There is no transmembrane helices in HpaG808512:RNA-p1.