CAZyme Information: HpaG808503:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG808503:RNA-p1
• CAZy Family: GH6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	HaraEmoy2_SC0082|CGC2	30207.43	8.9388

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0082:20254-21096(+)

Full Sequence      

MNKKDGYNECTYTTSPDFTLHSNIFHATLIQSRRNQYLRLSLPMYPSIKLLYLFIPQSSQ
CHTPKNTRSFPLSPPRPPTMTKIAIIYYSTYGHIAKMAESIKAGVESVAGATADVYQVQE
TLSDEVLSKMHAPSKQDHPVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWTA
GALVGKPAGIFFSTGTQGGGQETTAFTTVTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSP
WGAGNLAGTDGSRQPSQLEKDVAKVQGESFAQVAKKLSSA

Enzyme Prediction     

EC	1.6.5.6:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	82	276	6.9e-83	0.9948717948717949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
179647	PRK03767	6.94e-91	80	277	1	198	NAD(P)H:quinone oxidoreductase; Provisional
130816	flav_wrbA	3.51e-76	81	277	1	197	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
223728	WrbA	1.78e-51	79	278	2	206	Multimeric flavodoxin WrbA [Energy production and conversion].
397438	FMN_red	1.47e-10	81	224	1	143	NADPH-dependent FMN reductase.
223508	SsuE	4.24e-06	82	200	2	115	NAD(P)H-dependent FMN reductase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE81611.1|AA6	9.34e-80	82	276	2	199
CDM84515.1|AA6	2.63e-77	82	277	4	199
SPT18006.1|AA6	7.76e-77	81	279	3	203
CCG23266.1|AA6	1.09e-76	82	276	70	265
SPT16511.1|AA6	1.14e-76	81	279	3	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MP4_A	1.23e-67	80	276	1	197	The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_B The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_C The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_D The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_E The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_F The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_G The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_H The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
2R96_A	2.90e-55	80	278	1	197	Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
4LA4_A	5.41e-55	81	279	3	205	Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]
3ZHO_A	1.59e-54	82	278	2	196	X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]
4DY4_A	1.59e-54	82	278	2	196	High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9AYU0|QR2_TRIVS	1.15e-76	81	277	3	200	Quinone-oxidoreductase QR2 OS=Triphysaria versicolor OX=64093 PE=1 SV=1
sp|Q9LSQ5|FQR1_ARATH	7.82e-72	81	277	3	199	NAD(P)H dehydrogenase (quinone) FQR1 OS=Arabidopsis thaliana OX=3702 GN=FQR1 PE=1 SV=1
sp|Q6NQE2|FQRL1_ARATH	3.73e-70	81	277	3	199	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27270 PE=1 SV=1
sp|P25349|YCP4_YEAST	4.06e-69	80	277	1	200	Flavoprotein-like protein YCP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCP4 PE=1 SV=1
sp|P30821|P25_SCHPO	1.78e-67	79	270	3	195	P25 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=obr1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000016

TMHMM  Annotations     

There is no transmembrane helices in HpaG808503:RNA-p1.