CAZyme Information: HpaG808244:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG808244:RNA-p1
• CAZy Family: GH53
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		38559.77	6.4947

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0077:42065-43131(+)

Full Sequence      

MAPRRRSLHFEAHHGSLWLNGQPFVIKGASYFGMESDIGVPHGLWGGPQSTTLADVATLL
HSHHFNLIRVPFAVAAVANNIEIDRSKMGNEVAFLEAFPGHKTLRYLDVLDHVVHELERH
ELLVLLDAHVMQLGSSILNLWYNDSQDCSQKVVEKVWATLATRYAGQWNVLGADLNNEPH
GDATWGTNDVTTDWRLAAMKLAGKVLTVCPHWLIFVQGVQTTSCDSGYEMPCFWGENFQA
AVLHPLHLSVAKRLVYCPHTYGPAVSWQPYFNADDFPENMPSVWDCHFGYLKQQSDVPLV
IGEWGGCRENAKDWAWQNRFVEYLQHIGRHGWSTMCRLAFT

Enzyme Prediction     

No EC number prediction in HpaG808244:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	20	326	3.7e-80	0.9290322580645162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.89e-29	20	333	4	267	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.24e-25	23	322	44	338	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28856.1|GH5_1	7.47e-188	5	327	2	323
ARV61444.1|CBM2|GH5_1	1.92e-67	21	325	68	360
BAY20966.1|CBM2|GH5_1	4.91e-67	21	325	73	365
QFS47444.1|CBM2|GH5_1	7.51e-67	21	325	56	348
BAY65919.1|CBM2|GH5_1	9.86e-67	21	325	68	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	1.77e-57	23	324	27	333	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	3.50e-57	23	324	27	333	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.21e-56	23	324	60	366	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.21e-56	23	324	60	366	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	4.68e-56	23	324	60	366	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	4.57e-59	20	324	50	340	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P19487|GUNA_XANCP	3.65e-51	20	328	38	330	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P54583|GUN1_ACIC1	3.88e-51	20	331	58	351	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	4.24e-34	20	332	641	965	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	3.15e-30	21	306	58	352	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HpaG808244:RNA-p1.