CAZyme Information: HpaG807400:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG807400:RNA-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	HaraEmoy2_SC0063|CGC1	50816.07	6.4927

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0063:173697-175102(-)

Full Sequence      

MGLPPLSHGGPRSSMMSVEYDGIPLPPPSIRSCGSQQYVTSYIPTGTAFPPHSVQDLISS
MKSYASATDLVRTYSDIPSVEEALVTLDRAAVALSARRYRDALKLYLEGGYAMANVAERQ
THAKICNLLTSKGFETLNWCARLCDWIEGRVQEKHPRPGVHKVGIPVSNWDEDWLGPCLD
EEEARRLWYTPVFCPHPLDFSNFGYRLRCVETGRRPRLMVCITMYNEEPAQLKATLKKLA
NNLAYLKEQQQTGQSQRKNGLTGPFAGDNVWQNVLVCIVADGREQVNDKMLEYLESIGLY
DEDLLTINSAGIGAQCHLFEHTLQLSVNGKCLLPIQTVFALKERKSSKLDSHRWYFNAFA
EQVQPEYTAVMDVGTMLTKSALYHLLFAMERNHQIGGACGQLTVDKAFENLSNWVVSAQH
FEYKISNILDKGVLSLSLRSLFEGAPLECVLPDA

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	224	389	1.1e-50	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.30e-63	224	389	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	1.82e-25	220	431	1	137	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	3.81e-08	338	436	56	147	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
400626	Chitin_synth_1N	2.94e-04	189	223	37	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	0.002	329	442	106	213	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC77247.1|GT2	2.32e-281	1	448	16	471
ARC77246.1|GT2	2.32e-281	1	448	16	471
ARC77248.1|GT2	9.37e-281	1	448	16	471
ARC77245.1|GT2	1.33e-280	1	448	16	471
AGT99185.1|GT2	3.79e-280	1	448	16	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MPK_A	7.18e-11	79	147	3	71	Characterization and structure of the MIT1 domain of a chitin synthase from the Oomycete Saprolegnia monoica [Saprolegnia monoica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	1.14e-55	130	454	155	447	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P14180|CHS2_YEAST	1.61e-46	162	436	238	507	Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS2 PE=1 SV=1
sp|J9VGT6|CHS8_CRYNH	2.72e-45	177	436	332	591	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|Q12632|CHS1_MUCCL	1.17e-44	180	436	132	386	Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus OX=29924 GN=CHS1 PE=3 SV=1
sp|J9VWT0|CHS6_CRYNH	1.49e-44	177	436	294	553	Chitin synthase 6 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS6 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HpaG807400:RNA-p1.