CAZyme Information: HpaG805611:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG805611:RNA-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
123		14831.67	4.5272

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0041:3241-3674(-)

Full Sequence      

MASNEDWTYMDTLRPPVYICLRRKIDYSDADYRPMKLDGDVDKDEWKHVPWSEAFVDIEG
HERKPVEYPITRFKMMYDDEMLYIAAELLEPKVWGTITEKNSTLYHENDFEVFLNPDGSR
HRY

Enzyme Prediction     

No EC number prediction in HpaG805611:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	38	123	8.1e-21	0.44505494505494503

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187678	CBM9_like_3	1.89e-27	37	123	1	84	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
187676	CBM9_like_2	4.25e-08	34	91	10	66	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UII32709.1|CBM0	3.75e-29	13	123	16	131
QUR47585.1|CBM0	1.09e-27	2	123	25	139
QXD16319.1|CBM9	2.69e-27	34	123	43	131
QWG09162.1|CBM9	4.09e-27	35	123	1	88
QLG42346.1|CBM0	1.95e-26	24	123	10	114

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NWN_AAA	4.91e-07	30	120	25	104	Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWO_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWP_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWQ_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B]

Swiss-Prot Hits     

HpaG805611:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000086	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HpaG805611:RNA-p1.