CAZyme Information: HpaG805382:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG805382:RNA-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		38231.14	4.2018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0038:199743-200834(-)

Full Sequence      

MKVASSTAMMTAAFSVAYAADTCDQWGQTKSGNYIIYNNLWGSSAATGGGKQCTGLDSGS
GDTVAWHTVWSWMGGDTSVKSYANAALTFDAVPLTEVDSIPSSIEFKVKYSGKAVANVAY
DLFTSSTAEGEKKFEIMIWMAAIGGAGPISSTGKPIDTAKIAGVEWSVFSGPNGQMVVYS
FVASKPSNNFEGDLMEFFDYLAKSQKFKMRQYLIKVECGMEPFIGKDVSLTVSKYSTVVK
TGKSGSSTSSDSSAKSDDDVTQTDPTSSSDNEVGGKAEAGDDLLSALGGTPSSDDKATKA
SPDDETAEPGADEKEEEKEEEETADLEPESSAGKEEPDSTSADVTSATIAIPTVKSKCIL
RRN

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	93	237	9.3e-38	0.9615384615384616

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	3.49e-45	32	239	1	206	Glycosyl hydrolase family 12.
235746	PRK06215	4.32e-22	3	188	19	186	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22031.1|GH12	5.67e-121	1	269	1	269
ABB22039.1|GH12	3.48e-119	1	248	1	247
ABB22030.1|GH12	7.10e-93	1	248	1	247
ABB22038.1|GH12	1.19e-91	12	244	13	244
EAA66551.1|GH12|3.2.1.151	6.40e-82	6	239	7	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VL8_A	1.07e-78	15	240	7	229	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	1.20e-78	20	240	5	222	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
4NPR_A	5.57e-74	16	239	21	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
5GM3_A	4.81e-50	20	240	1	219	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
6K9D_A	2.59e-49	23	239	4	217	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	1.14e-82	6	239	7	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|Q0CRC9|XGEA_ASPTN	9.27e-82	15	239	26	249	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|W2PDG1|XLP1_PHYPN	1.01e-80	19	239	18	237	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|O94218|XGEA_ASPAC	6.50e-79	6	240	7	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus aculeatus OX=5053 GN=xgeA PE=1 SV=1
sp|A1CRJ0|XGEA_ASPCL	9.24e-77	19	236	19	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000553	0.999420	CS pos: 19-20. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in HpaG805382:RNA-p1.