CAZyme Information: HpaG804997:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG804997:RNA-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	HaraEmoy2_SC0034|CGC1	60149.62	8.9098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0034:94032-95615(+)

Full Sequence      

MNKREGKDRSCRDKTLMQQLRLYSRRQYIVLAVLGAIVFVIWVQSHKGTTVSIKPKLQST
TLSEPRTPTSIAKDENPTKEAPELRTPTAVKKDENPTKEAPELRTPTSITKDENPTKEAP
ELGIPTAITKDENLTKEAPEMRTPTAVTKDDHLNEETPQLTTPTAVTKDENVKKKKKPKK
KKRSEVPKGPVTSVLRPMTPDLPPLNPDVAFQITSSSDEFDEYHELFPQYGKNESGEHYR
IENTRVLAQPGNRETDSVLIICVFNDARSWGENRTIADFFELVGSFDYNREKISITLLTS
SNAEFLTIQKLFLTYIHEFPRLSLILRNDFAQGGLTRSNRHRPSLQGNRRRMLARYRNYA
LLSTMQSWHQHVVWLDADTKLIPSYLLAKMVHSGLDILTPVCYINVRGTMMNYDLNAWVG
ERSVRPPTHLNGTYVPRPLHVEFLNQIDKSKEPFAPIDSVGGTMVYVRAEVHRQGILFPV
HYVIGSEWGREGYDGIETEGLCYTASFLGFKCWGMINEMIVHTKEHW

Enzyme Prediction     

No EC number prediction in HpaG804997:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	237	480	1.2e-37	0.9701492537313433

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.07e-33	237	479	3	262	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
282904	Herpes_BLLF1	3.14e-06	59	164	481	587	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.
411474	fibronec_FbpA	0.001	65	171	181	293	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
411408	PspC_subgroup_2	0.005	44	207	133	290	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
411474	fibronec_FbpA	0.006	59	200	158	277	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86269.2|GT62	8.00e-45	252	525	87	399
SGZ55043.1|GT62	3.23e-44	256	527	85	380
SGZ55181.1|GT62	3.23e-44	256	527	85	380
UJR11041.1|GT62	1.11e-43	258	524	69	369
CCE80338.1|GT62	2.99e-43	242	525	70	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.17e-13	319	525	89	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O36022|MNN9_SCHPO	4.21e-19	232	525	40	337	Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnn9 PE=3 SV=1
sp|O74745|ANP1_SCHPO	1.11e-16	279	525	116	374	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	5.04e-15	325	525	216	421	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	2.17e-14	325	525	309	514	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P39107|MNN9_YEAST	2.92e-13	319	525	179	392	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000020

TMHMM  Annotations     

Start	End
28	45