CAZyme Information: HpaG804446:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG804446:RNA-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		94982.39	7.2041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0028:547467-550037(-)

Full Sequence      

MRQDHRTLTHLVYDFSLRLLDIKDVILSMPEGPSALADTRAHLSVRSSVRNRKHHYLTAA
RTSMKISAATLIGIGTVLQHLHLVHVAGQEFDDNESIIFSDSSHVEASTFAPALNNITSN
VTDGGDANMLVSSDLLPMEVGGNAPSEFRALIPPSNLFERTKAMMSLCPPKYLDPSVIKN
RAIPTNNWWGNIIAHDSNAAIQPIWSNPYSLQMVVDKAPFGMSASYPYRSRFSGGSSGNN
GAVKYYAHGMVREFLFSAEEIVGQKPNFQVIDWADQGVTVKFTASSSGGSMVSDIVSGMV
YASMKYSGLTPRLVSVTAISTVNGRPFGGRVRGSKFEIVYNSGQKWVVVALSSDGRTAKD
ITLAADGTSSLKSTGVFDGVLRVAVVLGDSWVSTLEKHKSCIVQAANVDLRDDSSYVFRW
KTMGDCSSGLLHFAMKHHTETLVTSSGVRPVDGMVAHSTTRGAHQAFITPGGPGDPVWEI
KETQPVPEDFYPSRKIASSVSRQQRIVDHLREDINNTWSIPLNGSYYFNGKAAQKYASLC
LLANDAVVVGEDKRLLNKCLVKLRGVMAPFVANSWDNKLQYDQVYGGIVSSQSFNTKDLN
SDFGNTMYNDHHFHYGYWIHTAAIINRLDPTWSDLSKLNNMVDLLVRDVANFDQDDKFFA
RFRSFDWFRGHSYSHGVTPFADGKDQESTSEDVNFAFGMYMYGKATKNAAMEAVGKLMTR
VNAHAIKTYFLVEDANQVHPANFRPNKVTGIFFDNKVDYATWFSAEKYCIHGIQMIPVSA
VTEFVRTKQFVKEEWEQVLDKEAIVAHEDTANSWLSLLYTNFAMVDKQRAMRVLQTAEMD
DGLSRSWALYMAASFA

Enzyme Prediction     

No EC number prediction in HpaG804446:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	179	850	1e-176	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	7.63e-153	499	849	3	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.07e-134	93	856	19	756	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.60e-36	183	469	15	300	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20872.1|GH81	0.0	64	856	1	793
UIZ20875.1|GH81	0.0	64	856	1	793
UIZ20868.1|GH81	0.0	64	856	1	793
UIZ20873.1|GH81	0.0	64	856	1	793
CCA25006.1|GH81	1.74e-278	143	856	26	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.02e-94	181	854	39	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.37e-93	181	854	64	742	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.12e-90	181	854	39	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.57e-29	182	846	34	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.17e-23	503	843	340	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	2.68e-86	183	853	35	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.02e-85	183	853	226	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.45e-76	183	855	111	778	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.91e-74	154	856	411	1113	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	9.06e-74	270	853	163	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HpaG804446:RNA-p1.