CAZyme Information: HpaG803689:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG803689:RNA-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		58892.31	5.7298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0022:186973-188785(+)

Full Sequence      

MSSSGRMSGTGRGSFSGGRSSEVERIIAAADVDTTFAGKKARYRGRRSTWPGALALLLLA
IVSVAGLTYYGIQVHDDVNETEATSEAASEAKFTDGTQISDGNPMDRTSSLTITNPKTYT
DRKCEQPNYISRKGRIFAQLADGSSTQIDIKGINWKGMEDAKGVPKGLWDNKADGNSLYR
YAHFLHVNKFNVVRFPLSIDAVMRNTDIDTNLINTNSNRALATASRYNTLLGLLVQGLGQ
FNIGVVLDFHVLSALDDDGSGLWYGPSIKLVDIKTAISNLAEALCDSTHFNIIGIDLKDG
LMKDATWGDGSDTDWSVAATELGNHMLKVCPKWLAFVQGVQGESHKDTYGDREIKNTFLP
GSDLSGLGEKPIKLKKDEKVVYAPKYFSSSYIPRLFFFENGTTNGDLLEEYVEYTDADLL
ANVQLNMNYSFGAAFDTGNAVVLSSFGGLMGKLDATGKQTSTRIIKSVISQMTGLTEPYL
AGGFWWTLNPDTSWPYPSPDNSSATGQGLLDPTWRIANKDVLGVLASMGKTMSSVKFIPC
ST

Enzyme Prediction     

No EC number prediction in HpaG803689:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	147	492	1.3e-127	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.32e-05	142	496	39	372	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25210.1|GH5_20	0.0	1	542	1	542
CCA23923.1|GH5_20	5.35e-183	11	540	7	535
CCD28218.1|GH5_20	1.13e-152	265	541	3	279
ABC87090.1|GH5_20	1.33e-98	19	540	112	627
ABK59037.1|GH5_20	1.33e-98	19	540	112	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	1.29e-21	139	526	12	348	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	7.73e-21	139	526	12	348	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
2ZUM_A	1.51e-19	140	542	53	426	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	1.51e-19	140	542	53	426	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3W6M_A	1.87e-19	140	514	20	361	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	1.66e-19	139	526	53	389	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	1.57e-16	139	531	33	371	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P23548|GUN_PAEPO	3.07e-15	139	523	45	379	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999811	0.000205

TMHMM  Annotations     

Start	End
50	72