CAZyme Information: HpaG802214:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG802214:RNA-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		20856.03	7.6626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0011:577106-577717(+)

Full Sequence      

MNFAASIGTLMLMASTAIAQCADVHVVFARGSGEMAGLGICGGPFVRSLTSNLYGMSVSS
YAVNYLALATQTSAGPGASDMSNHVMQMAQHCPNTVFVLGGYSQGASVTDIAIGIKTILG
RGTVIPEYLAPRIKAIVTFGNPLRLTGETIASASALYGSKAIEFCNFGDPVCANGANVLA
HTRYPTDGSVMKAASQAAALVMY

Enzyme Prediction     

No EC number prediction in HpaG802214:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	20	198	8.1e-50	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.92e-38	20	201	1	169	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAX55266.1|CE5	8.22e-96	19	201	26	208
AAO92431.1|CE5	1.17e-94	6	201	10	209
AAO92430.1|CE5	1.17e-94	6	201	10	209
EEY60079.1|CE5	4.20e-93	7	201	11	206
AAY43367.1|CE5	2.39e-92	7	200	11	205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	7.70e-16	21	193	79	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1BS9_A	6.31e-10	20	187	1	193	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
2AXE_A	6.31e-10	20	187	1	193	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
4OYY_A	7.35e-10	21	172	17	163	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1G66_A	8.68e-10	21	187	2	193	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	2.51e-60	19	201	34	218	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P9WP39|CULP3_MYCTU	2.43e-38	21	175	44	198	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|P9WP38|CULP3_MYCTO	2.43e-38	21	175	44	198	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|P0A537|CULP3_MYCBO	2.43e-38	21	175	44	198	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP42|CULP1_MYCTO	1.48e-35	21	198	35	210	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999717	CS pos: 19-20. Pr: 0.9844

TMHMM  Annotations     

There is no transmembrane helices in HpaG802214:RNA-p1.