CAZyme Information: HpaG802205:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG802205:RNA-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		67295.52	4.7385

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0011:485436-487452(-)

Full Sequence      

MMRPTMAARPSTSIHHDISVGQLDDPGLATGAGPAKTYTGRKVVWPGALFLLLATAAALS
LIAYFGIQEYTAAQTQQALTEEVTDVTRARKRKSTSVKSCMLPDYIAADGKIYAQNSFTR
KKEPLVFTGINWSGMENAEGVPHGLATKQSYLDDIAKNLSDSGFNAVRLPLNAQMIIDNT
APNTKLFVNSLDTDLNVDTYIDMIKKVVQGLGKQQIGVLLDIHKIDPNFTNDTSEHLWFT
DAYPIAKIYEMFETLASELCSDLEYNIVGIDLKNEPVGXXXXKSVWNFSHVESVYKPYCH
GSSGCDDYCDPGVNWPRAVETIGNKILSICPNWLIVAEGNYAIGTTSEINGANLTYNDWY
GASLQNASMNPIVLAIEGKLVFAPHFYSPSVYPSSYFFKKQSSSGSTVSVTEFPNTAEGN
KLLEGAVTAVLDNAFGNAVTATGIPTFYGEFGGIYGTAELLEGHTSTRTIDILIEYANTM
NMTGGFVWGLNPDGSYDFNNAYQPDDPWQYGLYTDSTWEKFHTDFATSLQSLKGSGPFPC
FMKTTIKTFSTSGSGSATITADSTTDTPTAKTPTTGTAAAPAAIGSPPSSTTAAATTPAA
PATPAAPVAPGAAVKKTATATSDATATAL

Enzyme Prediction     

No EC number prediction in HpaG802205:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	123	494	4.5e-133	0.9941860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.84e-17	112	506	31	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	5.04e-15	146	494	24	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24458.1|GH5_20	2.33e-313	1	569	44	591
ABL75348.1|GH5_20	3.15e-311	1	548	48	574
ABL75347.1|GH5_20	3.14e-308	1	551	47	576
CCA27479.1|GH5_20	1.72e-177	2	543	41	577
CCA26601.1|GH5_20	1.32e-172	27	541	63	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	2.92e-32	124	493	20	324	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
3W6M_A	1.04e-31	112	505	15	360	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	1.42e-31	112	505	15	360	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	4.92e-31	112	505	48	393	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
1VRX_A	6.36e-31	124	493	20	324	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	2.29e-30	124	493	61	365	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	4.51e-28	127	493	56	355	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P10474|GUNB_CALSA	1.95e-22	102	398	621	902	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	3.01e-20	126	399	62	318	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999851	0.000165

TMHMM  Annotations     

Start	End
43	65