CAZyme Information: HpaG802002:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG802002:RNA-p1
• CAZy Family: CBM48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624		70757.41	4.7863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0010:444825-446699(+)

Full Sequence      

MLPKVPPFGLQTYYPYTYREMAPEINGTVRYYEHGIHNDLMLSAREFNESRPTYEVYVWS
DMGIKLRLCSRGSINCIDSALSSGMAFVSGTYKGLTPRIETEYNITFVEESVPGKFIVYL
NNNQTWVLYASDVSLSLRVEESVNFSMNASGSSLVADDTYAGTIRVAILPEGAADTLYDD
YVSCIVRGGTVSMESRTGYSLTWDAEGSSCDTVGLLHFALPHQVESMIGSPITAETPGAI
MLNSTTRGLMVAQVSMRWSFVVPEADIAIDYYPDRKRLSLYLIRETDMLRTLQDDIYANW
TLATNSWYFNGKALQKYASLCLMAADSLVVGPDTNGLLAYCIEKLETLVEPLLNNTLSPP
LVYETLYGGVVSGLIFDTGQLYMDFGSGIYNDHHYHFGYYVTPAAIIRHLDPTWSRMSEL
EDLIWMLLRDVTNPSLEDPIYPRFRHFSWYHGHSYSRGVTLLDHGKDQESTSEDLNFYYG
MTLWGKETGHKALEDLGSLMLRLNAYTVREYFLLSSDNKIHPPEIVRNRVTGIFFDNKVY
YNTWFLDEKYAIHGIQMIPVSPANALARTPAFVTEEWNEILSKEPIVTMKNSNNTWLSLL
WVNAAVVNKMDSLYKLMNATWMMA

Enzyme Prediction     

No EC number prediction in HpaG802002:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	22	620	6.7e-145	0.8713826366559485

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	9.11e-118	304	621	28	334	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.92e-115	19	613	136	726	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	4.26e-40	26	273	68	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26131.1|GH81	0.0	1	620	81	697
UIZ26137.1|GH81	0.0	1	620	191	807
UIZ26602.1|GH81	0.0	1	620	191	807
UIZ26438.1|GH81	2.51e-260	2	620	114	723
UIZ26440.1|GH81	2.51e-260	2	620	114	723

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	6.24e-85	39	612	114	693	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.01e-84	39	612	139	718	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.47e-81	39	612	114	693	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	9.07e-26	166	581	203	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.62e-22	391	616	439	658	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	6.08e-83	81	612	187	707	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	1.29e-80	29	608	289	868	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.46e-73	27	612	517	1111	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.05e-71	83	606	147	666	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	6.78e-69	70	612	532	1081	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HpaG802002:RNA-p1.