CAZyme Information: HpaG801234:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG801234:RNA-p1
• CAZy Family: AA2|AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	HaraEmoy2_SC0006|CGC1	43221.55	6.8963

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0006:84698-85822(-)

Full Sequence      

MASSSLQARLRRGEVPCRGVNLGGWLVAEHWMTWDSCVWHGVPDDIKNQGEYATMKFLGH
EEGDRRFDEHRRTWITESDIAEIKRFGLNVVRVPVGYWIMGYDPTDISNKQEWTVFAPYA
LRYLDELVNHWCVKYDVPVIVDIHAAKGSQNGRDHSAAVTSGVTYWGQYPENVDNTVHLA
KFLASRYRDSPAFVGLGLLNEPEHPTDQNVLRGYYERAYSEIRATGNDCVLTVAPLLTEQ
RPPCMEDFMRFPKFVNVWHEWHPYFLWGYEGQKRIQVLQAIRRYGDQISSWSGNWLLIDE
WSLGAQSCAFPSEDRHGLRQFASAQLEAFSKAHSGWIFWSWRHSDDGHNRPTGWSMRQLL
RDGVIRLRGTTGGR

Enzyme Prediction     

No EC number prediction in HpaG801234:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	68	346	6.3e-44	0.9711191335740073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.78e-24	73	357	72	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.72e-11	74	341	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM18484.1|GH5	4.72e-259	1	367	4	370
UIZ29723.1|GH5	1.23e-248	6	367	1	362
CCA15861.1|GH5	2.06e-156	5	367	11	374
CCA15900.1|GH5	3.67e-139	6	367	102	454
UJR33211.1|GH5	1.69e-116	2	367	26	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	7.86e-33	18	365	10	378	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	1.66e-32	18	365	16	384	Chain A, Hypothetical protein XOG1 [Candida albicans]
3O6A_A	2.25e-32	18	365	15	383	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	2.88e-32	18	365	10	378	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.16e-32	18	365	16	384	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12725|EXG_YARLI	9.71e-39	13	365	33	406	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2
sp|Q96V64|EXG_BLUGR	3.93e-37	18	365	38	403	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	1.95e-36	18	365	30	390	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q12700|EXG_SCHOC	3.82e-36	19	365	44	410	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	3.75e-35	18	365	38	410	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HpaG801234:RNA-p1.