CAZyme Information: HpaG800829:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG800829:RNA-p1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		66921.29	7.6084

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0004:482339-484078(-)

Full Sequence      

MLQRLVVMIYSLCTLLQRVKHKKWFLLVLVSFYMGLRSTQKDPIVGKSRDVHINNMNTQK
IDDGIHMAPTRVGAPWTNASFECVGWKRIQSCREEKPEDEEKSEPLEPEKDILGCSEEVG
PQMAGYCIVRNRTSGDLYKLMVSSCDSLPTGSSYTCDMARDFSEFGYHSVKYEHKPVAPT
LALPLAATSRRRPTNGVLMIIYDRVLPSAYATIRMLRLQSCVLPVELWYRPDEMSIDNPI
VYKLLSEYNVRMRPIFDRRAMGFHVKPYAVYYSNFDNVLLLDADNLPAKDPTYLFEEPEF
LRTGAIFWPDYWQPSNSLFELSNTSLLWQITGVKFVDMFEQESGQVLIDRLRSKRALDKL
MFYSTHQPRLLEQLHLIWGDKDLFRLAWLNSSQPFHFIKYPPAVGGLDLRKEKGVFCGLA
MIQHDVQGNLVFFHRNSIKLDGKPDQPRIMSHIQEYSLEGDPRDYRIFQAVYAHRECCYY
IGTDSLPDGRPATQVTPIDSTIYASVEQLAIQFSVEARQLLIDDALASNLGFRSMRMEHI
VALFLLVYVLVIIAFVWCNGRPARERLPSRWKPMESKER

Enzyme Prediction     

No EC number prediction in HpaG800829:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	195	425	2.1e-48	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.76e-35	196	425	3	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.004	275	320	90	143	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28362.1|GT71	0.0	4	578	589	1162
CCA20955.1|GT71	6.68e-225	19	579	25	612
UIZ27901.1|GT71	6.03e-115	76	520	65	508
AIG56191.1|GT71	1.91e-109	76	520	38	489
UIZ29182.1|GT71	5.53e-104	76	529	61	498

PDB Hits     

HpaG800829:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	1.18e-15	169	416	222	486	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	2.32e-14	209	425	185	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AP90|MNN23_CANAL	1.24e-09	170	399	149	425	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|Q59WF4|MNN2_CANAL	1.62e-09	194	312	186	312	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	4.15e-09	212	419	310	554	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.964210	0.035805

TMHMM  Annotations     

Start	End
540	559