CAZyme Information: HpaG800766:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG800766:RNA-p1
• CAZy Family: PL3|PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575		65305.53	6.7597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0004:139777-141504(-)

Full Sequence      

MTPIRSSPVINRSKRQPWFSVLVLFTTFSTACRASIASKSKIKTPATLAPESIVEPLEGA
FATILYDYGEDSEALLLATRVLMRSIKDSNTKYRRLVIVPQDGLQESSEQTLKSDDPDVE
IVRTSMPNVFRYVPLTDHRSQLLHMRNKMVIWDDPRISALKRVVYLDPENLVLRNLDEIF
ACHQFCAVDNGQSVVYSNGLLVISPECLAARNLYSDAIDGFMITGREYNYIGIIQGFIPG
LFEAFEESPLFFLEGDKGKKEDESDGADDADDAGEADDHSIVHRLPFYYSINHMVFYERM
NWDLYKCKDKNLATGEIPGPLLSYKYSGATIKPWFWLPYTYFQVFWYWQDVRDRLGENHF
GYFLGKVMSSFVIAAFVWIVYVSLCLKLFTEPNGQPRRLSSSGLPTPGNAQPFDVFNSRA
VRRACQFSCSILHAVASMPLVSAFSIVGLLTWCSIQVIPTTMQPSYAGKLWLIVHDLMLT
TLLLIFAVAHTLRTAHWKTDEVPAISEFLVGGVCWCLKKLPLLVLAQLQFLYVLRRTDWF
QDPVLRPVVAIVFFTVAASVEGRILIVEMHRVTRN

Enzyme Prediction     

No EC number prediction in HpaG800766:RNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	3.77e-15	60	238	2	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	1.13e-303	65	575	1	515
CCA23792.1|GT8	3.32e-165	43	565	33	572
CCA16211.1|GT8	2.90e-18	60	394	48	370
UIZ21271.1|GT8	3.92e-18	60	387	38	364
QCD81290.1|GT8	1.00e-15	60	393	49	331

PDB Hits     

HpaG800766:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZP6|GUX8_ARATH	1.78e-14	58	352	62	313	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|F4JMI5|GUX7_ARATH	1.28e-13	58	336	58	294	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8GWB7|GUX6_ARATH	5.18e-11	60	251	32	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001802	0.998176	CS pos: 31-32. Pr: 0.9405

TMHMM  Annotations     

Start	End
367	389
429	451
471	488
508	530
545	567