CAZyme Information: HpaG800208:RNA-p1

Basic Information

• Species: Hyaloperonospora arabidopsidis
• Lineage: Oomycota; NA; ; Peronosporaceae; Hyaloperonospora; Hyaloperonospora arabidopsidis
• CAZyme ID: HpaG800208:RNA-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35532.99	9.8106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HarabidopsidisEmoy2	14267	559515	285	13982

• Gene Location: location=HaraEmoy2_SC0001:966314-967598(+)

Full Sequence      

MGSRVRSAAAAGEFLCVFLFLQKLSQTSTLAPDMGYRQGLLAAVNDFFLYKLAWVYVDAK
AAKWALLCQLFSWFTFYVMVRPFSNCVETVCTTAALALWPWKFLEDGAERKKRSNASSMK
HTHRTLALMFAALGVLFRPTNVVIWLYPGVLHFLQTRGRAHLVFGVVLPIAIVTLLAMLC
IDRLGYGEWTFVPINFFKFNVLEGKDKLYGEHPWSWYFSQGYPAIVGTALPMVLVGYFTI
PSSKKDIGQFRFVLPLLPPAFMYAGYCLRNLELGLYVQLRDSTQSTLLRLAAALVIVPNV
LTAYYLSRSHQVRC

Enzyme Prediction     

No EC number prediction in HpaG800208:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	6	311	4e-52	0.7557840616966581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	3.44e-48	17	311	98	413	mannosyltransferase
281842	Glyco_transf_22	7.12e-44	5	311	52	367	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26527.1|GT22	2.52e-103	3	243	60	285
BBN14164.1|GT22	4.58e-56	38	272	136	377
CAB4105495.1|GT22	3.68e-54	38	311	119	399
ACL52519.1|GT22	2.06e-52	38	311	128	417
ACN35056.1|GT22	5.60e-52	38	311	128	417

PDB Hits     

HpaG800208:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94A15|APTG1_ARATH	5.37e-50	17	311	98	413	Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
sp|Q1LZA0|PIGB_BOVIN	9.69e-48	38	311	137	398	GPI mannosyltransferase 3 OS=Bos taurus OX=9913 GN=PIGB PE=2 SV=1
sp|Q9JJQ0|PIGB_MOUSE	7.24e-46	32	311	132	397	GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
sp|Q92521|PIGB_HUMAN	3.22e-45	38	272	147	382	GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
sp|Q4V7R2|PIGB_XENLA	3.22e-44	38	272	135	370	GPI mannosyltransferase 3 OS=Xenopus laevis OX=8355 GN=pigb PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993004	0.006995

TMHMM  Annotations     

Start	End
61	80
127	149
162	181
216	238
250	272
287	306