CAZyme Information: HVAS_10923030.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10923030.1-p1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37760.65	5.5566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01092303:1100-2290(-)

Full Sequence      

TSNQPDGIDTSQTQSLDYQDVYNELATVLIGPNHTKFFPIALRLAWHSCGTYDKTTGTGG
CNGATMRYPCEANDAADKGLDLIRNRLEPVYNKFKDFQLTHADLWTLAGVFAVQEAGGPD
IPWRNGRDDLNQSHCPPDGRLPDADKSYRHVRQVFTRLGFNDQVGSILCIFNVKETVALI
GAHTLGGAHINNSSTDTYSCFMYYLVVMLMVLNHLTDHDGIWTIAPLKFGNFFFVNLLTE
KWVRKNWTAGLQFEDERTHRLMMLNADLALIEDSIYKPWVETYAKDSTIFYQDFSKVFAR
LLELGVPNDNFKAREPFVLKRLASVDDTMDTYT

Enzyme Prediction     

No EC number prediction in HVAS_10923030.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	34	196	9e-37	0.5803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	6.87e-103	17	309	12	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	4.07e-60	39	305	32	243	L-ascorbate peroxidase
178467	PLN02879	1.75e-50	29	305	27	246	L-ascorbate peroxidase
173823	plant_peroxidase_like	9.73e-48	31	303	11	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
166005	PLN02364	1.59e-46	39	305	34	246	L-ascorbate peroxidase 1

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83235.1|AA2	3.59e-84	14	320	154	426
QKX53632.1|AA2	1.41e-83	17	320	88	355
QGA20343.1|AA2	1.20e-82	17	320	90	357
BCS12828.1|AA2	5.40e-82	17	320	94	361
BCS01074.1|AA2	5.40e-82	17	320	94	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	9.43e-60	17	322	18	289	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
1JDR_A	2.09e-58	17	322	18	289	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
1KRJ_A	8.25e-58	17	322	18	289	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
4CVI_A	2.31e-57	17	322	18	289	Neutron Structure of Ferric Cytochrome c Peroxidase - Deuterium exchanged at room temperature [Saccharomyces cerevisiae]
4NFG_A	2.31e-57	17	322	18	289	K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	1.02e-82	17	320	94	363	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	7.00e-82	17	321	89	359	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	6.60e-80	10	315	105	377	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	1.63e-79	17	307	83	340	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	2.59e-78	17	307	86	343	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999851	0.000191

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10923030.1-p1.