CAZyme Information: HVAS_10858050.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10858050.1-p1
• CAZy Family: GT59
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		36619.15	7.6924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01085805:1624-3328(-)

Full Sequence      

MTYKTILLLSFYLITATEVTISSSYNVNSTQRLSSSPDCTGQLDYQAVYNDIANVLPDSN
FDDGSYAPIIMRLALHASVTYDPATNTGGSNGATMRFCPEKNYPANRGMENARNRLEPIY
HKYSELGLTYSDLWTLGGVCAIQETGGPKVAWRAGRKDGQPGDSPPDGRFPNPRNGAYHL
RQVFYRLKFNDQQLVALSGGHTLGRCHLARSGFDGPWTFTPINFTNAYYKLLKEEHWQLK
KWKGAPQYEDQRTQSLVMLPTDLSLTKDAILRYWVDRYAENQDLFFKDFSASFSTLLELG
VPSQNFQGRYPTLFKTMAEQNICN

Enzyme Prediction     

No EC number prediction in HVAS_10858050.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	48	301	5.4e-55	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	1.64e-120	44	302	12	251	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	2.28e-72	67	300	31	243	L-ascorbate peroxidase
178467	PLN02879	6.26e-58	67	300	34	246	L-ascorbate peroxidase
223453	KatG	3.39e-54	42	320	66	435	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
173823	plant_peroxidase_like	2.04e-52	46	298	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ73110.1|AA2	3.73e-109	34	302	71	336
UKZ46524.1|AA2	6.80e-108	34	302	151	416
QYS94482.1|AA2	7.18e-107	42	302	80	337
QRV94226.1|AA2	6.93e-105	44	306	95	355
QRV79589.1|AA2	9.82e-105	44	306	95	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	2.57e-69	44	322	18	294	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
2V2E_A	2.89e-68	44	322	18	294	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	3.07e-68	44	322	20	296	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
1JDR_A	5.77e-68	44	322	18	294	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
1STQ_A	5.77e-68	44	322	18	294	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4PBY6|CCPR_USTMA	7.05e-110	42	324	110	398	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	2.36e-106	44	317	86	356	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	1.00e-103	44	319	88	362	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|Q6URB0|CCPR_CRYNH	1.14e-103	41	308	103	368	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CCP1 PE=3 SV=1
sp|P0CP54|CCPR_CRYNJ	2.62e-102	41	313	103	373	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999745	CS pos: 24-25. Pr: 0.7753

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10858050.1-p1.