CAZyme Information: HVAS_10802461.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10802461.1-p1
• CAZy Family: GT58
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		33626.16	6.4842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01080246:5153-6423(+)

Full Sequence      

MFWFKLVPPAFPTLPIIQIIGWVKKFKLIIDWHNTTHSIVALKFGEGKAGEKLVRLVYLF
VEESSFQSITLLESWFGKNAFLHLFVTAAERDSLVADWKLCGSTQVFYDRPPENFHKLSP
NEIHQLWSRLPLAQEPTFTDYLSSLLSGTMTQTPFTTIDQDGQVILRPDRPALLISSTSW
TADEDFMLLLDALSLYSSKANVNSQLPKIICLITGKGPLKEYYMKLIEKRRVEEEWKKVG
CWSIWLECEDYDRLLGCGDLGICLHFSSSGLDLPMKVVDMFGCGLPVCAKQYKW

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	8	293	3e-89	0.6047058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	1.72e-103	8	293	103	347	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	1.10e-73	1	292	90	341	transferase, transferring glycosyl groups
340816	Glycosyltransferase_GTB-type	0.001	179	287	118	214	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV76128.1|GT33	2.20e-80	8	293	49	327
AAW41187.1|GT33	3.60e-78	8	293	151	418
KGB75402.1|GT33	2.01e-77	8	293	151	418
UOH79650.1|GT33	6.71e-77	8	293	54	321
ADV19846.1|GT33	7.92e-77	8	293	151	418

PDB Hits     

HVAS_10802461.1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q921Q3|ALG1_MOUSE	4.19e-58	8	293	132	395	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q9BT22|ALG1_HUMAN	1.18e-56	8	293	132	395	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q5R7A2|ALG1_PONAB	3.27e-56	8	293	132	395	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|P90522|ALG1_DICDI	1.33e-53	8	293	115	386	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1
sp|Q8L7M0|TUN_ARATH	1.27e-50	8	292	109	387	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999956	0.000110

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10802461.1-p1.