CAZyme Information: HVAS_10492110.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10492110.1-p1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		47064.94	5.7101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01049211:7445-9081(-)

Full Sequence      

MNVSMAHHDGPSVFMDWETKQKHIEFAKAGKVIPDDELDKVNDNAAIMESNILFNSVWGF
ALTCPPNSPIRSYDQAGFQLLNPKDAGPGYIGLDHAATMNVCDHPEWRELHASVCLPTWY
FEGFTSWPGPRPGVLRPIFSFAQSAFASDILDAPLEQFEDVSKNVDDLYKWSEKPLLKQP
LFWRGKSTGVWFDRTSKWRSSHRVRLHSLAKAFGLKRRVRFFNSTEGNISEHELDIGELN
KKYLDAEFVDELVQCSQEDGSCEAVSKELTFGEFVSWPIQNSYKFILDIDGNSWSGRFRR
LLASNSVIFKSTIWPEWLPWYHYVPVRIDYKDLYDLMAFFTGDMEGRGGHDKLAEHMAIH
GHDWVKNHFRFEDVQAYMWRTYLEWGRVTSENRASMNYKYDPNDDL

Enzyme Prediction     

No EC number prediction in HVAS_10492110.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	135	389	3.4e-51	0.896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.28e-14	119	378	14	242	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.96e-09	246	379	171	313	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40913.1|GT90	1.61e-117	1	398	373	752
CDR40950.1|GT90	1.67e-74	1	401	300	705
CDR48932.1|GT90	7.70e-73	1	398	316	694
CDR40393.1|GT90	3.10e-71	1	392	260	635
CDR40723.1|GT90	3.47e-71	1	406	343	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.09e-10	240	392	200	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.73e-63	8	400	298	667	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	5.22e-10	240	392	228	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	7.22e-10	182	388	184	388	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.24e-09	240	392	228	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.19e-09	240	392	228	373	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000004

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10492110.1-p1.