CAZyme Information: HVAS_10255080.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10255080.1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711		81065.91	9.5301

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01025508:1090-3978(-)

Full Sequence      

MLFLTLISAFLRFWHIGHPKAIVFDEVHFGKFASAYIKRQFFFDVHPPLAKLLIAFQGWL
LGYDGKFEFANIGDSYVETQVPYVGLRALSAIFGSVTPSVVYAIMKESGYPTLACSLSAF
LIALDNAHVVQTRLILLDAPLIFFMACALLSYVKFYKYRYSEFTKPWWGWMITTGVFLSL
TISCKMVGLFTFATIGIAVAIDLWNMLDIRRGHSMDHIGKHFSARLFSLVFVPTVIYLFW
FWVHFAILNRSGAGDEFMSAAFQETLIGSPLTLNSEALYNALKQTFLEIRYGDTIVLQHR
ASKCFLHSHLHRYPVKYDDGRISSQGQQVTCYPHNDTNNNWIVEPTKEIPPFGRGRIVRH
KDVIRLRHVLTNSYLLTHDVASPSMPTNQEFTTWPAHANLAGRDPRSEETKFQVFIDEAH
DGQQWTTKSSHFQLRHEFTKVSMWARTFPVLPGWGFGQQEINGHKNYNDKTLIWVVDEIV
RDNTTAGSSRPPPPKPKQLRKLSFLRKYFELQIAMLQHNSGLIESHPYASGPANWPFLLA
GVSFWTGSLEERQQIYMVGNVAGWWMCVMALSVVAGIMGADQFARKRGISPIPDPWACHY
FPFFLMSRQTFLHHYLPSHLCSTLVAGAVFNFIMTETINYPVSVAGPSMRRRPTLFVEIP
SGARAALGAIVFIFIVVFWFFTPLTYGTPSLNPAEVNRRRILSSWSLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	4	245	4.3e-73	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	2	711	28	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.75e-78	3	249	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.22e-51	506	703	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.62e-16	305	476	11	185	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.24e-09	289	345	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR48201.1|GT39	0.0	6	711	98	808
QRW02771.1|GT39	3.19e-315	4	710	70	773
QRV73816.1|GT39	3.19e-315	4	710	70	773
QRW16888.1|GT39	3.68e-314	4	710	70	773
CCA66707.1|GT39	2.36e-300	4	710	74	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	7.24e-98	4	705	56	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	8.94e-94	5	707	72	753	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
3MAL_A	3.28e-07	287	480	16	190	Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana],3MAL_B Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana]
1T9F_A	5.58e-06	308	439	22	139	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	8.35e-206	5	711	55	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	2.96e-205	5	699	60	751	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.18e-197	4	711	65	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q8R2R1|POMT1_MOUSE	4.36e-109	4	711	44	746	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	7.06e-107	4	711	44	746	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.868346	0.131671

TMHMM  Annotations     

Start	End
41	63
83	105
134	156
176	198
226	248
561	580
611	633
660	682