CAZyme Information: HVAS_10252140.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10252140.1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
180		19672.31	8.2286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01025214:6776-7754(-)

Full Sequence      

MVKALDYVAGSWTPKTGSQSAFVAKCPTGEEPVSFQTGIAKLIKQGFKPSQIIAGVPAYA
NSWALKQPKLKVSRFGNLSTYIFQDHTDKPPQGGKADDRPGVDNCGNKTTWGGLWLVSEM
VEKGFLSADEMSGGKGYTRYVDPCSQTPYLTDNKLFFSYDDSESIRLKAEYVMAHQLAGL

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	3	180	1.3e-17	0.40540540540540543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.48e-18	1	180	172	326	Glyco_18 domain.
225862	ChiA	1.60e-15	1	180	239	415	Chitinase, GH18 family [Carbohydrate transport and metabolism].
395573	Glyco_hydro_18	4.92e-15	1	180	163	299	Glycosyl hydrolases family 18.
119365	GH18_chitinase	6.88e-14	1	180	197	314	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	3.98e-09	1	179	176	332	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	8.42e-43	8	180	226	398
ALL41259.1|GH18	2.13e-39	8	180	5	178
ALL40920.1|GH18	1.09e-30	55	180	2	127
CDR43393.1|GH18	2.70e-27	5	180	202	385
CDR44918.1|GH18	2.56e-21	5	180	217	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	5.01e-08	114	180	240	321	Structural insights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5GZU_A	1.32e-06	136	179	325	368	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.36e-06	136	179	576	619	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
3WD0_A	1.60e-06	42	180	279	404	Serratia marcescens Chitinase B, tetragonal form [Serratia marcescens],3WD1_A Serratia marcescens Chitinase B complexed with syn-triazole inhibitor [Serratia marcescens],3WD2_A Serratia marcescens Chitinase B complexed with azide inhibitor [Serratia marcescens],3WD3_A Serratia marcescens Chitinase B complexed with azide inhibitor [Serratia marcescens],3WD4_A Serratia marcescens Chitinase B complexed with azide inhibitor and quinoline compound [Serratia marcescens],4Z2G_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 26 [Serratia marcescens],4Z2H_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 29 [Serratia marcescens],4Z2I_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 30 [Serratia marcescens],4Z2J_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 31 [Serratia marcescens],4Z2K_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 32 [Serratia marcescens],4Z2L_A Serratia marcescens Chitinase B complexed with macrolide inhibitor 33 [Serratia marcescens]
7CB1_A	2.94e-06	42	180	279	404	Chain A, Chitinase B [Serratia marcescens],7CB1_B Chain B, Chitinase B [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11797|CHIB_SERMA	8.23e-06	42	180	275	400	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10252140.1-p1.