CAZyme Information: HVAS_10239160.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10239160.1-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847		94791.28	8.3931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01023916:1674-5703(+)

Full Sequence      

MAYNNNNNNNTNGNGNTYHINAGSPNHGSYEQEYYQQPSYGQPAQSPFETRPSSPATYYQ
QSNHSQFTNQPEYTESAEKMPFGSYQGINTSSSYNLQDPGVAAYPPQRLPSDARGPGGFL
RPSPPERAPSAASDDEWRRRARPVQRGITRRVKLTQGNFINEYPVPKAISNSVEEKWLPY
AASGPSKSLSGTNEFTHLRYSAATCDPDDFTASKGWTLRTRQYGRETELLIAITYYNEDK
ILFARTMHGVMINIRDICKSNSKFWNRSTEDGKPGWQRIVVALIFDGIGPCDKNVLDVLS
TIGVYQDGIMKREVDGKETVAHIFEYTSQLSVDSKPSLVAPHAQHEKSNLVPVQIIFCLK
QKNSKKINSHRWLFNAIGRQLDPEVCILIDAGTKPGKRSLYYLWQAFHNDKNLGGACGEI
YAMLKSGKKLLNPLVAAQNFEYKMSNILDKPLESAFGYVSVLPGAFSAYRYKALQGRPLQ
QYFHGDHTLADRLGKKGLNGMGIFTKNMFLAEDRILCFELVAKANYKWKLTYVKSAKGET
DVPPQFMPLSISSDSTSLAITHSPFQKIVSHFLIFNNRFSIIIQLLPHNGIYLWANQLIT
HWVNLVLQWIYLGALALQFVLALGNRPKGEQTTYVICFVIFSILSYYLLVCAIILTARAF
SDLSFKDSPLLTDKFHVLISGTNGVLLAALASTYGGTKGSDKVDALPTVQSSKEKTEEGT
VSDVVRTDEDLDANFKAVVGRAISPWSSEETKEKPTEDDGNKTFRTRLVSIWMLSNAGLA
VAIANVNGLNTSVTDEEKKQSTYFSRYHTVVYVWAVCDPIYWFSLFLDHIQFDAVLSTDM
NVEGSNN

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	235	407	2.7e-71	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.22e-99	235	407	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	5.80e-80	231	549	1	230	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	7.82e-34	151	234	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	2.37e-17	356	656	115	399	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	8.45e-16	346	474	46	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB70408.1|GT2	0.0	125	805	78	835
CDI55582.1|GT2	2.48e-293	83	815	65	879
CDU23614.1|GT2	1.56e-287	92	804	108	887
SJX65151.1|GT2	4.38e-285	74	804	95	889
CBQ69508.1|GT2	4.68e-285	74	804	97	891

PDB Hits     

HVAS_10239160.1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30598|CHS1_USTMA	1.83e-288	74	804	91	885	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|J9VMX7|CHS7_CRYNH	5.55e-264	130	792	117	850	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|P30602|CHS3_EXODE	1.95e-230	91	785	64	854	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P54267|CHSG_ASPFU	1.44e-225	27	799	26	875	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|Q00757|CHSB_EMENI	4.26e-223	132	785	123	862	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

Start	End
599	621
634	656
768	790
810	832