CAZyme Information: HVAS_10193120.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10193120.1-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		32810.93	8.4178

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01019312:6456-7618(-)

Full Sequence      

MSGSLTNNTRSKYHADNSGRRGAVKWAENPRNVERTKDFLAQLAAEFSKPEYYCTVVAIH
ALNEPAGYIGDGGNLLQTAKQYFIDGYNIVRNPHGSRSPPSNFLYTIHDSYQPLSYWQNT
FRPPHYEKVVLDTHVYTMFVNEQITMNDSARIKHYCDLIPLIRQSQSYMMTVVGEFTPAP
TDCAPRLNGGFFVSLTLQLMTKLKNLIFRQGIGNRYEGTFRNSTRIGSCAGKTGSSSTFS
SEYKRQLAMFFDVQTAMAETGSGWFMWAFKAENADDWSYDAGVKVFDGFL

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	15	272	2.1e-58	0.7491749174917491

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.24e-07	13	280	144	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ULM60696.1|GH5_9	1.50e-64	16	284	206	447
AJA37480.1|GH5_9	2.59e-62	16	283	208	460
CAD31110.1|GH5_9	7.07e-61	16	283	167	410
AAW43562.1|GH5_9	7.07e-61	16	283	167	410
QRW22725.1|GH5_9	3.82e-60	16	283	193	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CZ1_A	4.78e-25	16	279	139	369	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	4.78e-25	16	279	139	369	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	5.10e-25	16	279	145	375	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	5.10e-25	16	279	145	375	Chain A, Hypothetical protein XOG1 [Candida albicans]
3O6A_A	1.32e-24	16	279	144	374	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	2.41e-25	16	277	166	391	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q96V64|EXG_BLUGR	6.93e-25	16	279	163	394	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q12700|EXG_SCHOC	2.45e-24	16	277	172	399	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|P29717|EXG1_CANAL	2.75e-24	16	279	183	413	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|B8N151|EXGA_ASPFN	7.21e-24	16	283	155	391	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10193120.1-p1.