CAZyme Information: HVAS_10124010.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10124010.1-p1
• CAZy Family: GH26
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		21433.08	8.2965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01012401:6912-7659(+)

Full Sequence      

LGQTSIFRRKEHSNSLVQHLDYQEVYDELGKILIRGRTKFLPIALRLAWHNCGTFDKKTR
TGGSNGATMRFSCEASDEADKGLDLIRNMVQPVYEKFKDRNLTLADLWNLGGVLAVQEGG
GPDIPWRYGRQDLNESHCPPHNRLPNADKGPSHVREVFTRLGFNDQETVALIGAHSMGGA
HVKNSSTDTYR

Enzyme Prediction     

No EC number prediction in HVAS_10124010.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	41	187	8.5e-39	0.5607843137254902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	4.61e-72	21	185	12	172	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	5.36e-44	42	188	32	173	L-ascorbate peroxidase
178467	PLN02879	9.15e-42	22	185	6	173	L-ascorbate peroxidase
166005	PLN02364	1.17e-37	42	185	34	173	L-ascorbate peroxidase 1
395089	peroxidase	9.70e-35	25	182	1	156	Peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20343.1|AA2	4.88e-54	21	188	90	259
BCR83235.1|AA2	1.25e-53	14	188	150	326
QRD85779.1|AA2	1.14e-52	21	188	90	259
QMW29426.1|AA2	1.14e-52	21	188	90	259
QMW41498.1|AA2	1.14e-52	21	188	90	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3E2N_A	1.54e-42	21	185	18	178	Chain A, Cytochrome c peroxidase [synthetic construct]
4A78_A	2.70e-42	21	185	20	187	cytochrome c peroxidase M119W in complex with guiacol [Saccharomyces cerevisiae]
3R98_A	4.99e-42	21	185	17	184	Joint Neutron and X-ray structure of Cytochrome c peroxidase [Saccharomyces cerevisiae],3R99_A Joint Neutron and X-ray structure of Cytochrome c peroxidase [Saccharomyces cerevisiae],4XVA_A Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_C Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_E Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_G Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C]
1KOK_A	5.11e-42	21	185	18	185	Crystal Structure of Mesopone Cytochrome c Peroxidase (MpCcP) [Saccharomyces cerevisiae],1S73_A Crystal Structure of Mesopone Cytochrome c Peroxidase (R-isomer) [MpCcP-R] [Saccharomyces cerevisiae],1SBM_A Crystal Structure of Reduced Mesopone cytochrome c peroxidase (R-isomer) [Saccharomyces cerevisiae],1SDQ_A Structure of reduced-NO adduct of mesopone cytochrome c peroxidase [Saccharomyces cerevisiae],1Z53_A The 1.13 Angstrom Structure of Iron-free Cytochrome c Peroxidase [Saccharomyces cerevisiae],1ZBY_A High-Resolution Crystal Structure of Native (Resting) Cytochrome c Peroxidase (CcP) [Saccharomyces cerevisiae],1ZBZ_A High-Resolution Crystal Structure of Compound I intermediate of Cytochrome c Peroxidase (CcP) [Saccharomyces cerevisiae],2B0Z_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],2B10_A Crystal Structure of the Protein-Protein Complex between F82S cytochrome c and cytochrome c peroxidase [Saccharomyces cerevisiae],2B10_C Crystal Structure of the Protein-Protein Complex between F82S cytochrome c and cytochrome c peroxidase [Saccharomyces cerevisiae],2B11_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],2B11_C Chain C, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],2B12_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],2CYP_A Crystal structure of yeast cytochrome C peroxidase refined at 1.7-angstroms resolution [Saccharomyces cerevisiae],2YCG_A Structure of unreduced ferric cytochrome c peroxidase obtained by multicrystal method [Saccharomyces cerevisiae]
1KRJ_A	5.11e-42	21	185	18	185	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	4.91e-52	21	188	94	263	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	7.37e-52	21	188	112	281	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	1.72e-51	21	188	89	258	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q6CAB5|CCPR2_YARLI	2.16e-50	21	185	5	171	Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=YALI0D04268g PE=3 SV=1
sp|Q6C0Z6|CCPR_YARLI	3.20e-50	21	185	68	234	Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10124010.1-p1.