CAZyme Information: HVAS_10115420.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10115420.1-p1
• CAZy Family: GH26
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		54028.12	9.3228

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01011542:4253-6073(-)

Full Sequence      

MKVAGFPRKLWLVLLSLAFLAAFFWQHIVLLVHILSVYVLWPLLSAHLAISKVGDGFDPS
FVSYPLRQYSAVWPPHHANQSALTDLLRLQNGSLAVLAPSESSHADLVPPILHHILLGMD
RSTIPSAWEASRNSCLALHPTEANYTHYFWTDSSANAFMQQHYPQHFTHFLSYKYNIQRA
DALRYYVLHHFGGIFLDLDLECLRSLGPLRRFPVVNVNAFPVGVSNGFMMAQRAHPFLAQ
LISNLALYDRSWLGISYIDIMLSTGPMFLSTEHLRYPYSLRSKHLRVLAESSHRLNGRTV
TPLFRHLGASSWHQNDAKFFLGLRHFANPVAFIIVMIFFTCLSAIGAWWSFSRLVNMRRR
MSGRIRYVALEVASDDDVDDSPTSPNRKPRRRWVDARFVLWLRSGRRFRVRLPLVETSSS
SSYSSLACSDEEHLDDVEMALSASAMTEDDDLRSPDILQMEQLAFPSKRVSQQ

Enzyme Prediction     

No EC number prediction in HVAS_10115420.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	128	209	2.4e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.60e-29	124	327	95	296	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.13e-14	125	209	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN02868.1|GT32	2.90e-119	64	335	3	289
UJR26144.1|GT32	1.36e-71	23	317	34	290
UNI15446.1|GT32	1.87e-62	50	328	61	301
UKZ97012.1|GT32	1.98e-62	11	352	23	333
ANH56537.1|GT32	7.29e-62	3	335	11	308

PDB Hits     

HVAS_10115420.1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	4.35e-41	103	325	57	272	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	3.53e-40	97	325	44	264	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.23e-40	100	378	74	345	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.67e-38	98	363	57	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	7.34e-38	102	339	51	281	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000016

TMHMM  Annotations     

Start	End
12	34
329	351