CAZyme Information: HVAS_10114630.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10114630.1-p1
• CAZy Family: GH20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		30545.93	6.9738

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01011463:4753-6290(-)

Full Sequence      

MFDIRLGSRGDSYYEYLLKQYLQTNRKEGVYKENYDRAMRGIKKHLIASTPKGLVFTGEL
ASRGGEYKFIPKQDHLVCFLGGSFLLGVTEGGRLVESKNILRLSESEKEDWHIGKELIKT
CMDTYQKSKTGLGPEIVHFRQMPEKSSATSSNQREWFINNYSSLRPPWDARNMLRPETVE
SLFLAWRVTQDPIYRLSSPRGSFATITDVDAISPEKEDKMETFWLSETLKYLFLLFSEDS
VLPLDKYVFNTEAHPLPIFEPIIM

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	4	258	2.2e-65	0.5381165919282511

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	4.33e-104	3	258	206	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.36e-85	4	261	281	521	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR38387.1|GH47	5.81e-90	3	261	296	572
QRW05345.1|GH47	1.86e-88	3	261	317	598
QRV76440.1|GH47	1.86e-88	3	261	317	598
QRV91276.1|GH47	2.88e-87	3	261	317	598
QRW19503.1|GH47	6.87e-85	3	261	290	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FO2_A	8.52e-57	6	261	219	459	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	4.06e-56	6	261	297	537	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	4.18e-56	6	261	214	454	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
5KIJ_A	7.73e-56	6	259	214	452	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	8.80e-56	6	259	219	457	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q93Y37|MNS3_ARATH	3.19e-64	3	258	349	620	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|Q8J0Q0|MNS1_CANAX	1.26e-61	4	260	246	510	Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans OX=5476 GN=MNS1 PE=3 SV=2
sp|Q9UKM7|MA1B1_HUMAN	2.32e-54	6	261	458	698	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|Q9P7C3|MNS1_SCHPO	1.69e-53	3	260	255	513	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	5.17e-53	6	261	416	656	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10114630.1-p1.