CAZyme Information: HVAS_10067781.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10067781.1-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
144		16103.25	6.4619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01006778:11286-11941(+)

Full Sequence      

DNFAITPVQTPISNIKVFNTLWIWELSPASQKLVMDVSYDIWVSKSPGGSHSNEIMVWLG
AYQGAAPTGQADGNSYTTSNGKYKFDIWVGKVEFWRVISLVPANNAKYTKFSADLKHLMN
FLVKNYNIGSDEYITQIASGLEPF

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	10	144	3.3e-27	0.8653846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	6.65e-08	2	144	51	190	Glycosyl hydrolase family 12.
235746	PRK06215	0.007	36	139	123	221	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW10751.1|GH12	1.55e-23	12	144	110	237
QRV81970.1|GH12	1.67e-22	12	144	110	237
QBH72468.1|GH12	3.46e-22	2	144	83	221
AEV23011.1|GH12|3.2.1.151	1.89e-21	2	144	83	221
BAN51847.1|GH12	6.57e-20	12	144	95	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	7.17e-23	2	144	88	226	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VLB_B	1.38e-16	2	144	67	205	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	1.54e-16	2	144	74	212	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D4F1|XGEA_NEOFI	6.14e-23	2	144	83	221	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xgeA PE=3 SV=1
sp|Q4WJU8|XGEA_ASPFU	3.36e-22	2	144	83	221	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xgeA PE=3 SV=1
sp|B0XNQ1|XGEA_ASPFC	3.36e-22	2	144	83	221	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xgeA PE=3 SV=1
sp|G4ZHR2|XEG1_PHYSP	4.05e-20	2	144	84	224	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|Q5BG78|XGEA_EMENI	2.96e-19	2	144	84	222	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10067781.1-p1.