CAZyme Information: HVAS_10062900.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10062900.1-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		45498.40	7.7553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01006290:6125-7739(+)

Full Sequence      

MKSNVDPEDAIPLIENRALTHEVCERTFPKLYQEVMRARDFYSVRQPVSSEQLDLAITHA
HARVLIYQNRVFIKEFNGGPGKRTEAILNSIRRFFFKDISTFPITYILLIILPFFLEEAV
ITSTEKIPNVEFVVKTLDAPQEVDKNLPIWVLDRTEDQEELWLMPDYGFYSWPEPKVGSM
VEVRDKCQQVEKNLTWIEKIPKAFWRGAILVKLREELLKTAEGHNWSDISPLVWSKLEGR
LKTPEDHCQYKYLIHVEGYAYSGRLKYLQMCRSVVIAHQMTYIQHFHHLLDSNDGSPNQN
IIVTPGAGFSGLPQTMKKLIGDDTRAELIANNSQRIFRHHLSPAATNCYWRKMFRAWSEI
QGFQPFPRANETTFESFKCVKLVLSFVKEKG

Enzyme Prediction     

No EC number prediction in HVAS_10062900.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	126	361	4.4e-23	0.988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	1.14e-28	47	379	24	343	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.60e-20	126	363	1	255	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76195.2|GT0	2.00e-88	6	377	51	416
QSZ37094.1|GT0	1.38e-62	19	364	79	402
QMW31874.1|GT0	3.90e-59	16	358	93	418
QRD90937.1|GT0	3.90e-59	16	358	93	418
UDD60835.1|GT0	3.90e-59	16	358	93	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	3.04e-10	116	367	117	385	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	1.48e-13	117	364	127	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.52e-12	127	364	138	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q7ZVE6|PLGT2_DANRE	2.01e-12	121	365	220	470	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q29AU6|RUMI_DROPS	1.59e-09	116	367	127	395	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.60e-09	116	367	129	397	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

Start	End
94	116