CAZyme Information: HVAS_10050810.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10050810.1-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		28450.96	4.8067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01005081:1814-3058(+)

Full Sequence      

MVLQGIKDAGNVDLSVWLGIYIDGNDTVYERQMSALTSALTTYGVDHVAGITVGNEYLLL
SYGDNGAPTDAKGVQARTKLLNYVQQTNKTIQSLKLSKSIPLGTADAGSAITPELCAGVD
FVMANVHPWFGHVPIDQAATWTWQFFQDFDVTVCAKAPNNPITYIAETGWPTFSDNPSQL
GTGDLGASEHNLQKFMDTFVCQANTNGTNYLKDEPWKKKYGGVEPYWGIYSANGTMKNVN
IPNCPVNSPTGKAVVQPTIDGKS

Enzyme Prediction     

No EC number prediction in HVAS_10050810.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	13	237	9.8e-19	0.8327974276527331

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.08e-22	14	233	101	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.001	122	237	171	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41397.1|GH17	5.42e-141	1	263	79	348
ALL40855.1|GH17	2.03e-132	1	254	79	337
CDZ96384.1|GH17	9.89e-92	2	256	89	349
CED83523.1|GH17	2.46e-90	2	256	92	352
AAW47222.2|GH17	1.32e-84	1	244	245	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.27e-15	14	237	92	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.49e-14	14	237	92	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	1.87e-38	1	244	435	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	6.60e-38	1	244	435	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	6.60e-38	1	244	435	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|A1CAI0|BTGC_ASPCL	4.05e-36	1	244	442	689	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1
sp|A2QN74|BTGC_ASPNC	7.28e-36	1	244	431	678	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000002

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10050810.1-p1.