CAZyme Information: HVAS_10033410.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10033410.1-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		54422.68	8.6124

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01003341:2781-5066(-)

Full Sequence      

MIVSVEASNFLLRREEMEETIPISLFLENMSFVFAGSGQKTQVDWNYTTVPQKYANGKSI
DLPRGKVLGGSSALNYLMSTKSSRDDYDGLEAVGNPNWNWLTIDAASKKSEKLIIPPRSS
NYTYVENFHGKNGKVSSRFPLSIPPLVFSYFRAIKGLGHYFTKDAFGGNATGAWIYPSAI
SVNSTRVTNDDNVKKRKNLHIELNAEVVKVFTVSKNYAVTAVAVQYKKDGQFITVPASRE
VIISAGSLATPVILERSGFGDEKLLTKFNIPIQVHLPGVGNNLIDHPSITCLYRLQNGIF
SADELRINKTYFEEQTKLYQEQRKGIYADAVIALDYQPLSIVVDASEIEEGLSLIKTKPP
YLSKKVYEQIVKQVKSGSVLEFIPLDKFLALSHSKRIMQQPVWRGIIKDEVLPGPKVKTD
ADRSNDVKSRITHLELLRCYPEIKMEWLTHLCVSMEPEICELLMLVYAIAERAAEIIMKD
HKIE

Enzyme Prediction     

No EC number prediction in HVAS_10033410.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	348	6.6e-77	0.5669014084507042

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.55e-36	44	434	63	475	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.21e-34	44	286	64	299	choline dehydrogenase; Validated
366272	GMC_oxred_N	4.15e-23	55	287	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.83e-07	197	287	233	328	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KIS68002.1|AA3_2	2.61e-44	36	390	107	475
EAA59477.1|AA3_2	6.85e-44	35	371	82	429
UPL02288.1|AA3_2	1.87e-43	35	329	91	391
SAM84677.1|AA3_2	3.42e-43	36	343	108	424
CBQ68668.1|AA3_2	1.61e-42	36	343	107	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.03e-39	49	384	65	392	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	9.14e-33	44	286	59	312	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.21e-33	44	286	60	313	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	3.81e-28	43	285	61	315	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	2.40e-22	38	293	92	355	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2H3D1U1|ARMD5_ARMGA	5.86e-34	44	327	103	399	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.28e-31	37	429	99	549	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.28e-31	37	429	99	549	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.58e-30	44	352	71	394	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	2.30e-28	44	359	71	395	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000044

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10033410.1-p1.