CAZyme Information: HVAS_10024400.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10024400.1-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		90813.78	9.3337

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01002440:1061-3774(-)

Full Sequence      

MALDTVYPLINFSPYTSRLILAFLRILIVFLIAGAAISSRLFAVIRHESIIHEFDPWFNF
RASKVLTEQGFYAFWNWFDQTAWYPLGRVVGGTIYPGLMATSALIWNIFKSFNIPIDIRN
ICVLLAPGFSGLTAYAAYLFARELGQKSNSKGAAITDSIGKTGEGTGLWAALFIGIAPGY
ISRSVAGSYDNEAIAIFILMFTFYLWIKALKEGSALYGSFTALFYFYMVAAWGGYAFITN
ILPLHVLVLILMGRFTSRLYVAYSTFYVTGTLASMQVPFVGFQPIRSSEHMAALGVFGLL
QLVAFAEFVRSHVSSKQFAVILKLAIGSLSLIGFLSLILLTKLGWIAPWTGRFYSLFDTG
YAKIHIPIIASVSEHQPTSWTSFFFDLQMLIYLFPAGVFLCFKELRDEHVFVIIYAVVGS
YFAGVMVRLMLTLTPVVCVSAAMIVSSIFDLYLDPAQPHSAMDSLSSSGSRGSRTPVSSA
SSSAVGPFSSSANPTTPSKKSKRDSSLPSKPRSSTPSSAASYSSSSSLFSVCYAEHAIFG
LETRFGLVSLFTFFLIYFVLHCTWVTSTAYSSPSVVLASRNQDGSMNIIDDFREAYYWLR
QNTDPDAKVMSWWDYGYQIAGMADRTTLVDNNTWNNTQLTMSSREEVSYPILKKHDVDYV
LIIFGALIGFSGDDINKFLWMIRIAEGVWPDEVKEGDFFTSQGEYRVDDGATPTMRNSLM
YKMSYYRFNELFGGQRGQDRVRGQMLPQVGPTLDTLEEAFTSENWIVRIYKVKPEDPIGR
SHKELNAFMAGKRKKAGTSKKKKARRKSSAAAASST

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	21	731	1.5e-179	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	8.40e-131	23	455	1	419	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.87e-96	24	780	19	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	2.04e-22	53	727	32	636	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SAM85545.1|GT66	0.0	5	795	15	781
CDR48162.1|GT66	0.0	1	795	1	777
CDS81882.1|GT66	0.0	5	795	17	777
SJX65712.1|GT66	0.0	5	795	20	779
CBQ70063.1|GT66	0.0	5	795	20	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	2.06e-295	24	794	16	704	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	3.38e-268	28	776	76	776	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6S7O_A	1.15e-245	24	781	18	703	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTG_5	4.63e-245	24	781	18	703	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	1.93e-244	24	773	18	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	2.33e-302	24	795	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	1.06e-294	24	794	16	704	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q3TDQ1|STT3B_MOUSE	1.94e-268	28	776	73	773	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|E2RG47|STT3B_CANLF	1.23e-267	28	776	76	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	1.74e-267	28	776	76	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

Start	End
431	453
545	567
21	43
86	108
121	140
167	186
193	210
230	252
259	281
291	313
325	347
380	402
409	427